PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676713656
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CPP
Protein Properties Length: 696aa    MW: 76605.9 Da    PI: 5.3698
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676713656genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR25.82.1e-084074311640
        TCR  16 kYCeCfaagkkCseeCkCedCkNke 40 
                 YCeCfaag++C e C+C dC+Nk 
  676713656 407 SYCECFAAGVYCIEPCSCIDCFNKP 431
                6**********************96 PP

2TCR52.78.2e-17478516139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnCkks ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  676713656 478 RHKRGCNCKKSGCLKKYCECFQGGVGCSINCRCEGCKNA 516
                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163431.98391518IPR005172CRC domain
SMARTSM011145.1E-4405433IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.9E-5407430IPR005172CRC domain
SMARTSM011144.3E-18478519IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.5E-12480516IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MDTPQKSITQ IGTPISKSRF EDSPVFNYIN SLSPIRPVKS IQNPHQFSTL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHNSS SSSDPTIPVE DSLDESPTNE EVAEEAEPTK DFNIDASMGK  120
EASTEMEQPQ IIKHVGSGMT PDDPVAASPC GNDTTDLSLV PLGSPPGGEN GSFQDSPGME  180
MQNMHDNVQG KTETPDWESL IADASELLIF GSPNDSEAFR CLMMQRASTS QAPAGMPTMQ  240
SDSKIEPESS NVVPYEAVSV LHRGIRRRCL DFEMPGNKQT SRENNTSACE SSSRCVVPSI  300
GLHLNAILMS SKDCKTNVTH DYTCSEKNQV CLQGSSSTLQ ETLELTEHET REGADQDVPV  360
EPTMEELHLN SPKKKRQDSC LSWKLEKASH ALQKCVMFLS LLMFMCSYCE CFAAGVYCIE  420
PCSCIDCFNK PIHEDTVLAT RKQIESRNPL AFAPKVIRSS DSVQETGDDA SKTPASARHK  480
RGCNCKKSGC LKKYCECFQG GVGCSINCRC EGCKNAFGRK DGSCIVEMEA EQEEEKESSE  540
KNRKAKTQEN TEIYLMRKEE SSALPTTPMS IYRQQMLQVP FSSSKNMMPP PQSLLRGGSS  600
SGVYNSQYLR KPEINLTQSR TEKSFETVTE DRAEEMPEIL SHSPIDNIKA VSPNGKRVSP  660
PHLDSSSSGS ILGRRSGGRK LILQSIPLFP SLTPQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-1243351549120Protein lin-54 homolog
5fd3_B6e-1243351549120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676713656
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615391e-107AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankCP0026871e-107CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973371e-107Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282514.10.0protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGXP_006282514.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]