PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676712676
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family Nin-like
Protein Properties Length: 866aa    MW: 96284.4 Da    PI: 6.0601
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676712676genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.6e-29559609252
     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  676712676 559 DKTITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 609
                689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2543629IPR003035RWP-RK domain
PfamPF020421.9E-25561609IPR003035RWP-RK domain
SuperFamilySSF542774.66E-23739835No hitNo description
PROSITE profilePS5174528.239747830IPR000270PB1 domain
SMARTSM006662.2E-26747830IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.8E-21748827No hitNo description
CDDcd064078.80E-44748828No hitNo description
PfamPF005643.5E-19749829IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 866 aa     Download sequence    Send to blast
MEGSFLQTEN AVMDAEFMDG LLLDGCWLET TDGSEFLNLT PSTSSVAPFD PSSFMWSPTQ  60
DTSAICTPGV GTQVYSQDCA ERSSSLDEFQ WNKRWWIGPG GGGSSVTEKL VQAVEHIKDY  120
TTERGSLIQL WVPVNRGGKR VLTTKEQPFS HDPMCQRLAN YREISVNYHF SAEQDDSKAL  180
AGLPGRVFLG KLPEWTPDVR FFRSEEYPRV QHAQDCDVRG TLAIPVFEQG SKICLGVIEV  240
VMTTEMVKLR PQLESICRAL QAVDLRSTEL PIPSSLKGCD LSYKAALPEI RNLLRCACET  300
HKLPLAQTWV SCLQQTKSGC RHNDENYIHC VSTIDDACYV GDPTVREFHE ACSEHHLLKG  360
QGVAGQAFLT NGPCFSPDVS NYKKAEYPLS HHANMYGLHG AVAIRLRCIH TGSADFVLEF  420
FLPKDCDDLE EQRRMLNALS TIMAHVPRTL RTVTDKELEE ESEVIEREEI VTPKIENTSE  480
VHHPHGSSSW SGSLEEIQRS NISNPQNLGS VFDGGDKPND GFGLKRCFDY TRDSNVNESS  540
TFSTDGFSRM TEKKRTKADK TITLDVLRQY FAGSLKDAAK SIGVCPTTLK RICRQHGIQR  600
WPSRKIKKVG HSLQKIQRVI DSVEGVSGPL PIGSFYANFP NLASQSQEPS QQAKTSPPPP  660
PLQPSKSPVS PYSNSSSSSQ CCSSETQLNS GATTHPSQAD VGGALKKASS EIDLQSSSLD  720
ETVLTLSSLE NIPQGTNLLS SSQDDDLLRI KVSYGEEKIR FRMRNSRRLA DLLWEIGKRF  780
SIEDMSRYDL KYLDEDNEWV LLTCDEDVEE CVDVCRTTPS HTIKLLLHVS SHHFPERSSA  840
TGLLGSALGF VLKKAPERKH VKILSS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676712676
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306759.10.0protein NLP4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGXP_006306759.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein