PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676706754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family GeBP
Protein Properties Length: 322aa    MW: 37051.3 Da    PI: 6.8049
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676706754genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573101.76.3e-3269138271
     DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkk 71 
                lfqrlw++eDei lLqG+idfka+tgksp++d+d+fye  +ksisf+vsk+q+++Kir+LKkK+ kkv+ 
  676706754  69 LFQRLWTDEDEIYLLQGMIDFKADTGKSPKQDLDRFYELTRKSISFEVSKNQFLDKIRSLKKKYIKKVNL 138
                79***************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.4E-2370137IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MAKKKLNPPP SSSIHEEEEA EEQISDGSSP KEEEEAAVKS GKKRERGKTS KQVNAKRSKK  60
IVEDSKKHLF QRLWTDEDEI YLLQGMIDFK ADTGKSPKQD LDRFYELTRK SISFEVSKNQ  120
FLDKIRSLKK KYIKKVNLWG VEAFLKANGD NVEEDREVLA DVEEDREVLV NGEKVEEVRE  180
VLVGGKKVEE DKEVLVNGGD SKWSMVCVET KKRMEENWKL LQAKEMELVL QKTDFMRELN  240
AYVHSVSSAM LRQSNNSLLP VKLYVSVEKP FSQHYLASFL VCVYINSHSE LQQFNSVLCM  300
FIKYPSQNHL IALISNQNIL AA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14046GKKRERG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139614.13e-67PREDICTED: mediator-associated protein 1-like isoform X1
TrEMBLM4EV843e-67M4EV84_BRARP; Uncharacterized protein
STRINGBra032717.1-P8e-67(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.13e-36DNA-binding storekeeper protein-related transcriptional regulator