PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011102212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 124aa    MW: 13792.6 Da    PI: 4.4888
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011102212.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26084.91.1e-2617230101
          DUF260  30 fanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                     f  +h++FGasn++kll++lpe +r da++s+vyeA+ar+rdP+yG++g+i +lq+q+++l+ae+a++++e+
  XP_011102212.1   1 FITAHRVFGASNIIKLLQELPEAQRADAVNSMVYEANARLRDPIYGCTGMICHLQSQVSELQAEVAKAQAEI 72 
                     5689***************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031958.3E-26169IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089116.417172IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:1.20.58.602.0E-423122No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
FITAHRVFGA SNIIKLLQEL PEAQRADAVN SMVYEANARL RDPIYGCTGM ICHLQSQVSE  60
LQAEVAKAQA EILNMQCQNA SLIDLLCKGM AGTQNVEENL IYDHNSTIFS DEPNVGVSWE  120
HLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2417740116LOB family transfactor Ramosa2.1
5ly0_B2e-2417740116LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011102212.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011102212.13e-89LOB domain-containing protein 1-like, partial
SwissprotQ9LQR01e-43LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A4D9AES93e-58A0A4D9AES9_SALSN; Uncharacterized protein
STRINGMigut.F02029.1.p3e-56(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-46LOB domain-containing protein 1