PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101501.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 242aa    MW: 27856.5 Da    PI: 7.6142
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101501.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.2e-2072124456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + ++++eqle Le+ F+++ +++ +++ +LAk+lgL+ rq+ vWFqNrRa++k
  XP_011101501.1  72 KKRLSNEQLESLENSFQEEIKLDPDRKMKLAKELGLQPRQIAVWFQNRRARWK 124
                     5569************************************************9 PP

2HD-ZIP_I/II123.78.8e-4071162293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     kk+rls+eq+++LE+sF+ee kL+p+rK++la+eLglqprq+avWFqnrRAR+k+kqlE+ y+aLkr+yda+++++++L++ev +Lr+ lke
  XP_011101501.1  71 KKKRLSNEQLESLENSFQEEIKLDPDRKMKLAKELGLQPRQIAVWFQNRRARWKAKQLERLYDALKREYDAVSRDKQKLQQEVMALRAILKE 162
                     9**************************************************************************************88875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-1953128IPR009057Homeodomain-like
PROSITE profilePS5007117.0766126IPR001356Homeobox domain
SMARTSM003895.5E-1869130IPR001356Homeobox domain
CDDcd000868.14E-1771127No hitNo description
PfamPF000464.1E-1772124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-2173133IPR009057Homeodomain-like
PRINTSPR000317.3E-697106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000317.3E-6106122IPR000047Helix-turn-helix motif
PfamPF021834.8E-9126160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MDWNGNLRVP FVSRPAAVEN SYNFHYNFNY DQFPVLEMKQ PPMLTTPQQA MLPTLADKNN  60
SMMHNFGQDP KKKRLSNEQL ESLENSFQEE IKLDPDRKMK LAKELGLQPR QIAVWFQNRR  120
ARWKAKQLER LYDALKREYD AVSRDKQKLQ QEVMALRAIL KEHLAKKQVL STGYTDISGE  180
ETVESTSIPT SNDPSPPTTT NSLHQINADH QCNNNYGLNV DDYNNPVMMP PYWAAAAAPS  240
CP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKAKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101501.10.0PREDICTED: putative homeobox-leucine zipper protein ATHB-51
TrEMBLS8D9W81e-103S8D9W8_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc09g008810.2.11e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38692246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.11e-53homeobox 51