PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101386.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YA
Protein Properties Length: 345aa    MW: 37890.3 Da    PI: 8.8031
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101386.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.61.8e-32183237358
       CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     p+YVNaKQy++Il+RRq+Rakle+++kl +ks+kpylheSRh hAlrR+RgsgGrF
  XP_011101386.1 183 PIYVNAKQYNAILRRRQTRAKLEAQNKL-AKSKKPYLHESRHLHALRRARGSGGRF 237
                     9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-35179240IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.462180240IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.5E-28183237IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.9E-23183205IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860185205IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.9E-23214237IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MQSLSHKDTD QTTADSLATL FGGRSSLWFS TKHPKISLSK SGVTELETTG EHHYHVKLSE  60
SQYQEQDPSS LSSKQSHHEA VNLAKSDSHM QNISFQPGLF ETYKKRGDDC GAPSLIGGNG  120
DQVINQGQME PNQSSACMSY PLAGSYFGTT AAAYEPTGVV YPQMMGIAPA RVVLPLDYTE  180
GMPIYVNAKQ YNAILRRRQT RAKLEAQNKL AKSKKPYLHE SRHLHALRRA RGSGGRFLNT  240
KKMQQNPLNQ TYDKNLSSKQ KSGHASEPEI QHSESTSWGN SPTSGSDVSC IFNNDDGFQQ  300
PDLRVSFSTL TMGATAQIGA HPHVIAPDDK LLLSMDRCAR ISTAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-18183242463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101386.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like
RefseqXP_011101465.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like
TrEMBLA5PGU11e-108A5PGU1_ANTMA; YA2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48002027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.13e-41nuclear factor Y, subunit A3