PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101342.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 183aa    MW: 20213.7 Da    PI: 8.3659
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101342.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.33.5e-4510108199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++C+++pyfp e+p+kfanvhk+FGasnv+kll+++p+++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+
  XP_011101342.1  10 PCAACKFLRRKCTPGCIFSPYFPPEEPQKFANVHKIFGASNVSKLLHDIPPHQREDAVNSLAYEAEARVRDPVYGCVGAITFLQRQVDRLQKELD 104
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_011101342.1 105 AANA 108
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.6829110IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-4410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CTPGCIFSPY FPPEEPQKFA NVHKIFGASN VSKLLHDIPP  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIT FLQRQVDRLQ KELDAANADL IRYACNGGLH  120
QPSTNPMVVP PPRQRPIVEH NRRIANDGGS GFYQTPSSFS FPYYNSPWND HYGPHGGGFG  180
GSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-6631294130LOB family transfactor Ramosa2.1
5ly0_B6e-6631294130LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011101342.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101342.11e-135LOB domain-containing protein 25-like
RefseqXP_020546974.11e-135LOB domain-containing protein 25-like
RefseqXP_020546975.11e-135LOB domain-containing protein 25-like
SwissprotQ9FML42e-67LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A2G9H8M22e-87A0A2G9H8M2_9LAMI; Uncharacterized protein
STRINGEOY208511e-84(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.45e-70LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]