PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101183.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family FAR1
Protein Properties Length: 874aa    MW: 100488 Da    PI: 6.638
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101183.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR186.25.1e-2768154188
            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                     +fYn+YA+ vGFsvrk+  ++sk +g++++r+f+Cs++g+r+++k++ ++ +++r+etrtgC a+++v+++ +gk+ vt++e eHnHe
  XP_011101183.1  68 RFYNKYAELVGFSVRKDWVNRSKVHGRVMSRKFTCSRQGHRKKDKRD-VNVKKHRKETRTGCLAHMVVTRQPHGKYLVTQFEAEHNHE 154
                     5*******************************************999.999************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.3E-2468154IPR004330FAR1 DNA binding domain
PfamPF105513.1E-20281372IPR018289MULE transposase domain
PROSITE profilePS509669.248561597IPR007527Zinc finger, SWIM-type
PfamPF044344.8E-4570596IPR007527Zinc finger, SWIM-type
SMARTSM005759.7E-6572599IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 874 aa     Download sequence    Send to blast
MDVDEGDVLV THDEHMDVRM SNNLDLNVEH ECRSPKSSNP KGVHSSCSSK HEVLKIGTEF  60
ESDEQAYRFY NKYAELVGFS VRKDWVNRSK VHGRVMSRKF TCSRQGHRKK DKRDVNVKKH  120
RKETRTGCLA HMVVTRQPHG KYLVTQFEAE HNHEDVNLTK AQKLLESPLF GKGNSTEFSE  180
TDSMKNKEIH SNLSFQLLGI RFCPPDNFDD LQVSDEVFLS SGRTRDMKEG DAARLMYYFQ  240
RQHFENPSFF YSVQLDIDDK VSNIFWADDN MIVEYGHFGD VVCLDTSCAR NANSRPFVQF  300
VGLNNHRQAV TFGAAFLYDD SVNSFKWLVR TFVEAMSGKK PKFILSDQDA TVVQAIHAVL  360
PETSHCICAW QMYLIALKHL RHVVNEYESF TGDFRNCIFG HEQEEDFIQA WDSMLEKHGL  420
RHNAWLRWMF REKEKWAVAY GRNTFFIERN GTHLVELMSD RLRSYLGPDI DMLQFFKHFE  480
SVVNEQRYRE LESTLDMGRQ APVLMANAVL LKYPSETYTP MAFKVFQREY EKCLNVVVNK  540
CGERDSRFDF KVKTYGKSRE FLVIYNSLDG TVSCNCMKFE HVGFLCSHAL KVLDHQNIKV  600
VPSYYILRRW TKDARILPVG ESDSYPEDDN RKIVATRYKD LCRNIIKISA RAAESDTAFE  660
FAARQLNEVM QGVERILHFN TFEEAKGTCA SDNELADADL DRNDFEGQGV DVLKGTTETE  720
NMVPNKDQLN HCDDPIPGVS GGLAVRPSPP ETVLSVACGP STYISSPSPT PSLSPLTQGL  780
YTVEANHMVQ SMYQTSNLAI NQQSNPNMYE SPNFYSNQHH SPSHAQFLQD SLIRNQFQDP  840
MSNGTQMKQV MDDSQHTHSS SFMHYNHRYR AAGV
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011101183.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101183.10.0protein FAR1-RELATED SEQUENCE 5
RefseqXP_011101184.10.0protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2G9H3370.0A0A2G9H337_9LAMI; Uncharacterized protein
STRINGMigut.F01137.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.12e-96FAR1 family protein