PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011100794.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family CAMTA
Protein Properties Length: 875aa    MW: 98969.6 Da    PI: 7.2089
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011100794.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1137.63.9e-43109335118
            CG-1  35 ksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118
                     +sg+++L++rk++r+frkDG++wkkkkdgktv+E+he+LKvg+ e +++yYah+e+nptf rrcywlL+++le+ivlvhy+e++
  XP_011100794.1  10 TSGTIVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDNPTFVRRCYWLLDKSLEHIVLVHYRETQ 93 
                     79*******************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143761.923198IPR005559CG-1 DNA-binding domain
SMARTSM010769.5E-48193IPR005559CG-1 DNA-binding domain
PfamPF038591.3E-361091IPR005559CG-1 DNA-binding domain
SuperFamilySSF812962.99E-9328413IPR014756Immunoglobulin E-set
CDDcd002041.19E-13512622No hitNo description
Gene3DG3DSA:1.25.40.204.7E-15513625IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484033.11E-16513626IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029714.345521595IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008811.434563595IPR002110Ankyrin repeat
SMARTSM002485.1E-6563592IPR002110Ankyrin repeat
PfamPF000238.6E-5564594IPR002110Ankyrin repeat
SuperFamilySSF525401.04E-6670777IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS500967.163711737IPR000048IQ motif, EF-hand binding site
SMARTSM0001514726748IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.089730756IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0012749771IPR000048IQ motif, EF-hand binding site
PROSITE profilePS5009610.091750774IPR000048IQ motif, EF-hand binding site
PfamPF006129.4E-4751771IPR000048IQ motif, EF-hand binding site
SMARTSM0001535829851IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.114831859IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 875 aa     Download sequence    Send to blast
MRFMPYSVTT SGTIVLFDRK MLRNFRKDGH NWKKKKDGKT VKEAHEHLKV GNEERIHVYY  60
AHGEDNPTFV RRCYWLLDKS LEHIVLVHYR ETQELQGSPA TPVNSNSNSA GSDLSATWPM  120
SEESDSAVDR VYYGSTGSYL ECHDSVTVKH HEQRLYEINT LEWDELLVPD DPHRLITRQQ  180
GTTAGFELQN QYQMNSYRIN DDAPSNNKVS PECSTNSFSE PVAGRSSINY TSPNNMSYQT  240
VEQDTIVNSE TMVSGLMPSG GAGSLYNLGK DGLQSQDSFG RWVTHIIAES PESVDDHTLE  300
SSNLAGHQSS TYPLMDSHDS SPLGPIFTIT DVSPAWALST EETKILVVGF FNEGQLPYSE  360
SKLYLACGDS LLPVDVVQAG VFRCLIPPQA PKLGNLYITF DGHKPISQVL TFEIRAPVQP  420
GTVSFENKTD WEEFQLQMRL AHLLFSSSKG LSIYSTKLSP TALKEAKAFA QKTSHISDGW  480
LHMAKVIEDT KMSFPQAKDK LFELTLQNRL QEWLLEKVVA GCKISERDEQ GLGVIHLCSI  540
LGYTWAVYPY SWSGLSLDYR DKFGWTALHW AAYYGREKMV ATLLSAGAKP NLVTDPTSQN  600
PGGCSAHDLA SKNGYDGLAA YLAEKALVAQ FDDMTLAGNV SGSLQTTTNE TVNPGNFSED  660
ELYLKDTLAA YRTAADAAAR IQTAFREHSL KIRTKVVESS NPELEARNIV AAMKIQHAFR  720
NYETRKKIVA AARIQHRFRT WKIRKEFLNM RRQAIKIQAM FRGFQVRRQY RKIVWSVGVL  780
EKAILRWRLK RKGFRGLQVQ PAETPREPNE ESDVEEDFFQ ASRKQAEERV EQSVVRVQAM  840
FRSKQAQEAY RRMKLEHNKA KLEYEGLLHP DLQMG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00435DAPTransfer from AT4G16150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100793.10.0PREDICTED: calmodulin-binding transcription activator 5-like isoform X4
RefseqXP_011100794.10.0PREDICTED: calmodulin-binding transcription activator 5-like isoform X4
SwissprotO234630.0CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLA0A022RYH30.0A0A022RYH3_ERYGU; Uncharacterized protein
STRINGVIT_05s0077g01240.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.10.0calmodulin binding;transcription regulators