PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011100407.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family G2-like
Protein Properties Length: 376aa    MW: 41021.6 Da    PI: 9.1583
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011100407.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.91.9e-27102156156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k +++WtpeLH++Fv+ave+L G +kA+P++ilelm++++Lt+++v+SHLQkYR++
  XP_011100407.1 102 KVKVDWTPELHRQFVQAVEKL-GLDKAVPSKILELMGIECLTRHNVASHLQKYRSH 156
                     5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.53799158IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-26100159IPR009057Homeodomain-like
SuperFamilySSF466891.97E-18100159IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-26102156IPR006447Myb domain, plants
PfamPF002491.6E-8105154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MEPKAREFLV GAGEESEMST SINTSASIGK VDEESKTVAE QKASPVSASA SASNLGSGSS  60
LIQGEETVSN RGDSFVDNRS SLTGNKGRKP STHIKNLPGK RKVKVDWTPE LHRQFVQAVE  120
KLGLDKAVPS KILELMGIEC LTRHNVASHL QKYRSHRKHL LAREAEAATW SRKRQMYGTA  180
GRTAKRDVNS WAVPTTGFPP VTSMPQFRPL HVWGHPSTDQ PLMYMWPNHL TCSPAPPPAW  240
VPGHPLQPPI SGDPSFWSSH HQDVSAQQTN IFYQDCFAPH FQPTRFTIPP VAGVPPTSLY  300
RAEPGVGVPI VPTGQTLPQP SFDSHLQSTE SIDAVIGDVL SKPWLPLPLG LKPPSIDSVM  360
VELQRQGISK IPPTCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-1599154257ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011100407.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847450.11e-142PREDICTED: probable transcription factor GLK1 isoform X3
TrEMBLA0A2G9GES21e-155A0A2G9GES2_9LAMI; Uncharacterized protein
STRINGMigut.M00145.1.p1e-142(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-73GBF's pro-rich region-interacting factor 1