PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011100030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 328aa    MW: 36879.7 Da    PI: 4.4705
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011100030.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.5e-1863116356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++  +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  XP_011100030.1  63 KKRRLRVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 116
                     45578899*********************************************9 PP

2HD-ZIP_I/II127.46e-4162153192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl  +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++ydalk++ e+L++++++L +e+ 
  XP_011100030.1  62 EKKRRLRVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKHKYEQLQRDNDSLLNEIL 153
                     69*************************************************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-1956120IPR009057Homeodomain-like
PROSITE profilePS5007117.258118IPR001356Homeobox domain
SMARTSM003892.1E-1661122IPR001356Homeobox domain
CDDcd000867.79E-1763119No hitNo description
PfamPF000461.9E-1563116IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-1966125IPR009057Homeodomain-like
PRINTSPR000319.5E-68998IPR000047Helix-turn-helix motif
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
PRINTSPR000319.5E-698114IPR000047Helix-turn-helix motif
PfamPF021838.4E-17118159IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MKRSLGSSDS LGALMSICPN STDENSPKGD YPMYTREFQT MLEGLDEDCG GGCVEETGQV  60
SEKKRRLRVD QVKALEKNFE VENKLEPERK VKLAQELGLQ PRQVAVWFQN RRARWKTKQL  120
ERDYGVLKAN YDALKHKYEQ LQRDNDSLLN EILELKSKLN EGDGEHDSKV SVKEEPLVSE  180
TEAKTEIEAP FIELNFENCR NELTTMMREA SVFVDFKDGS SDSSDSSAIL NEDNNNSPVG  240
AAISSSAGGV LHHSPPAHDD EFLDNVHGIG LSSSAISLHQ LSDSKVYQPP QFVKIEEHNF  300
FGEECCSSLF SDDQPPTLHW DDCSDVWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110118RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function as a negative regulator of the flowering time response to photoperiod. May act to repress cell expansion during plant development. {ECO:0000269|PubMed:14623244}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011100030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100030.10.0homeobox-leucine zipper protein ATHB-6-like
SwissprotQ940J13e-77ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A2G9I4D61e-125A0A2G9I4D6_9LAMI; Transcription factor HEX
STRINGPOPTR_0005s07290.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.12e-72homeobox protein 16
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]