PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011099212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 338aa    MW: 37764.1 Da    PI: 7.1938
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011099212.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-4271061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk lrrkC+++Cv+apyfp ++p+kf nvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++++l+
  XP_011099212.1   7 PCAACKCLRRKCTQECVFAPYFPPDNPQKFTNVHKVFGASNVAKLLNELNASQREDAVNSLAYEAEYRLRDPVYGCVGLISILQHKLKQVQHDLD 101
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      +k+e
  XP_011099212.1 102 NAKKE 106
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4366107IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MSSSNSPCAA CKCLRRKCTQ ECVFAPYFPP DNPQKFTNVH KVFGASNVAK LLNELNASQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISILQ HKLKQVQHDL DNAKKELATY IGPSAMLPIL  120
NHPGFMQQHP NYAPSAYQVM PYNVQPMMGL PTGVPHGAQL MIREPQQQQQ QQQFLEAQAA  180
AAAREQEMLR TYEQQQQQQQ NDLVRFNSGF DDAAGPVPAT GFNQIPAAAG AAMQPSLALG  240
SSYETLPYHH IQQHGNVQEH SQTQSHTHSH HPHGHQLPLQ PHELLLQQQQ QQQNVSTHHQ  300
QQQQQQTQQQ LGQPQPSHSQ QQPPRAKSEE GRSIGPSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4731107114LOB family transfactor Ramosa2.1
5ly0_B3e-4731107114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011099212.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0545567e-84KJ054556.1 Sesamum indicum clone TilSSR_25757 microsatellite Sesame_25757 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020554582.10.0LOB domain-containing protein 36
SwissprotQ9FKZ32e-85LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A2G9GG501e-158A0A2G9GG50_9LAMI; Uncharacterized protein
STRINGSolyc02g065150.1.11e-113(Solanum lycopersicum)
STRINGMigut.H00465.1.p1e-112(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-79ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]