PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011098802.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family FAR1
Protein Properties Length: 878aa    MW: 99515.6 Da    PI: 6.3271
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011098802.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR171.61.7e-22200287190
            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     k+Yn+YA + GFs+rk+  ++sk +g +++r+++C ++g+ + +++   + +++r+etrtgC a+++++++++gk++v+++e+ HnHe++
  XP_011098802.1 200 KCYNRYALMEGFSIRKDFVNRSKVTGLVVSRRYTCHRQGYGSIKRDV--NVNKPRKETRTGCLAHMTITRQTNGKYRVIHFETRHNHEFV 287
                     58***************************************998765..9999***********************************97 PP

2FAR188.78.5e-28335424191
            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     +fYn+YA +vGFsvrk++ ++sk +g + +r+++C +eg+r+++k+   k +r+r+etr+gC a+l+++++ dg+++vt++e+ HnHel+p
  XP_011098802.1 335 EFYNAYAGRVGFSVRKDYVNRSKIDGAVASRRYTCFREGYRQKDKRG-LKVKRPRKETRVGCMAQLVISRQADGRYRVTHFEERHNHELVP 424
                     6*******************************************999.999**************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-20201287IPR004330FAR1 DNA binding domain
PfamPF031015.9E-25335424IPR004330FAR1 DNA binding domain
PfamPF105517.8E-26544638IPR018289MULE transposase domain
PROSITE profilePS5096610.583823859IPR007527Zinc finger, SWIM-type
SMARTSM005752.4E-6834861IPR006564Zinc finger, PMZ-type
PfamPF044345.1E-5834858IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 878 aa     Download sequence    Send to blast
MDPGVGVGVS SAFEDGIREK DGPNPRVDAD AEQTSEAPNF SCDAEVAFVQ VDASLSQEAS  60
SADKDGMDID SESTYSCLNG SSDENSVDSD GENGYTSQDG SSIDHHSLNK DTENGCQSPK  120
TFSGSGNNGP NIVGKQNDQS PGLSSDNQLG MDADDKHVSQ TTEAPSSASS GSGQVIKDEA  180
GEYVVPKLGV EFESEDHAYK CYNRYALMEG FSIRKDFVNR SKVTGLVVSR RYTCHRQGYG  240
SIKRDVNVNK PRKETRTGCL AHMTITRQTN GKYRVIHFET RHNHEFVTPF TAHLLPSQKR  300
ISFVEAVEAE SAVTPVPDGV PKLGMGFESE DHAYEFYNAY AGRVGFSVRK DYVNRSKIDG  360
AVASRRYTCF REGYRQKDKR GLKVKRPRKE TRVGCMAQLV ISRQADGRYR VTHFEERHNH  420
ELVPACKVRM LRSQKRSVTD QIVESTASGG SNMQPKSLAE LLLTGVGIQD FIYDPIDRET  480
RLTSKRVWNI KPDEPESIHQ YFQSKKLKDP SFFYAVQCDV DDEMTNFFWA DEKMLVDFGD  540
FGDVVCFDST SRINKEWRPL VLFLGINNHR QILVFGAAFL YDDSAQSFKW LFQTFKRAMS  600
GKTPKTIVSD KDAVISEAII SELPETHHRL CTWQIYQNAL KHLSQLVVNS DSFSSDLCGC  660
IYNPDEEDFV NSWKVLLDTY GLWGNEWLHG IFEEREKWAL PYRKHIFSAE IDTALLSEDS  720
ITSLKKYLKP ESHVLQFIKH IGKVVNDWRY KELEANYDMG QHMPRLMGDV IMLKQVREVY  780
TPVIFKTFHQ EYENCLNIVI NQCIDTVSSV EYKVSTYGQV RQYTVLYSSE DDSVACSCMK  840
FQFVGILCSH ALKVLDYRNI KIVPSQYILK RWTRDARA
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011098802.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098802.10.0protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_011098803.10.0protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_011098804.10.0protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2G9GNZ50.0A0A2G9GNZ5_9LAMI; Uncharacterized protein
STRINGMigut.H00048.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-100FAR1-related sequence 5