PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011098623.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ZF-HD
Protein Properties Length: 93aa    MW: 10236.4 Da    PI: 7.7383
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011098623.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.46.1e-322783360
     ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                    +vrY eC+kNhAa++Gg+avDGC+Efmp  geeg+  al+CaACgCHRnFHRre+e e
  XP_011098623.1 27 RVRYGECQKNHAANVGGYAVDGCREFMPC-GEEGSNGALTCAACGCHRNFHRREEEAE 83
                    79**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-26193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.8E-292880IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.9E-262979IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.6263079IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MKKRQVVLKR DDQFSSNFAN SSFAVRRVRY GECQKNHAAN VGGYAVDGCR EFMPCGEEGS  60
NGALTCAACG CHRNFHRREE EAEVVCDGSS PTT
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011098623.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098623.18e-64mini zinc finger protein 2
RefseqXP_011098624.18e-64mini zinc finger protein 2
SwissprotQ9LJW51e-35MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A2G9I4081e-47A0A2G9I408_9LAMI; Uncharacterized protein
STRINGXP_009596464.16e-44(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.11e-36mini zinc finger 2
Publications ? help Back to Top
  1. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]