PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011098342.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NAC
Protein Properties Length: 316aa    MW: 35229.4 Da    PI: 7.1783
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011098342.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.35.9e-53141391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF Ptdeel+v+yL++kv+g++++l +vi +vd+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ 
  XP_011098342.1  14 LPPGFRFYPTDEELLVQYLCRKVAGHHFPL-QVIGDVDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT- 106
                     79****************************.99***************8777899***********************************9999. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  XP_011098342.1 107 EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-6710163IPR003441NAC domain
PROSITE profilePS5100561.13314162IPR003441NAC domain
PfamPF023652.4E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGVPETDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGHH FPLQVIGDVD LYKFDPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLS ESPRKNGGNK LDDWVLCRIY KKNSGGGGGG QKPVVCSGQS  180
KEYSHGSPSQ SSCSSQHDDV LESFPEMNSL ENFEQEDQKL MNLQRLGSWN FDWATLAGLG  240
PIWAEEVQAQ HGQTRNGMYA PDAVMDDDVQ TGLVNNQRVH DSGFFPTGFG QGLSGSLDPF  300
GIRYPAQTTL GSGFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-10411667172NAC domain-containing protein 19
3swm_B1e-10411667172NAC domain-containing protein 19
3swm_C1e-10411667172NAC domain-containing protein 19
3swm_D1e-10411667172NAC domain-containing protein 19
3swp_A1e-10411667172NAC domain-containing protein 19
3swp_B1e-10411667172NAC domain-containing protein 19
3swp_C1e-10411667172NAC domain-containing protein 19
3swp_D1e-10411667172NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011098342.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098342.10.0NAC domain-containing protein 72
SwissprotA0A3Q7HH641e-126JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A2G9HYP81e-146A0A2G9HYP8_9LAMI; Uncharacterized protein
STRINGMigut.M00863.1.p1e-141(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-123NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]