PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011098254.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NZZ/SPL
Protein Properties Length: 428aa    MW: 46192.1 Da    PI: 7.5714
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011098254.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE24.45.2e-08409849105
          NOZZLE  49 sktaqqkqkkptlrgmgvaklerfiieeekkk..lvvatvgdtssvaaisntatrlpvp 105
                     s++   kqkk   rg+gva+le+ ++ee++kk  l va++    sv ++s++a  l v 
  XP_011098254.1  40 SRSKTAKQKKVPQRGLGVAQLEKIRLEEQQKKesLQVANILAKNSVGSSSDNAQFLAVQ 98 
                     5555667889999**************987763358999999999********988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087441.7E-53997IPR014855Plant transcription factor NOZZLE
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MAQEEHFFGC SYSGGGGSGG GGNGGGGGGG SGCGGGVSSS RSKTAKQKKV PQRGLGVAQL  60
EKIRLEEQQK KESLQVANIL AKNSVGSSSD NAQFLAVQCS KFRPGLSPLH KSDPNLEILH  120
ENSVQIPKNL NAGGGEIGVE AISSPGHENR PIWWNGEYNL PGEKQRLGTH GFAFEPQVSL  180
PYQSNSPFLP LPVVPQRSQQ FQWPCSSSSS VMNSSTGISA SSILSSQMEP PSNQSSRGNN  240
YVPSWSEEEK MVGMKRSYPF LVESQPSRSL HCNFHPSYAA SLSRSDEFDS CSNGYKAHME  300
PRNKCVRESS SNSSPQPEQN PSEVTRDKGM LNGDFLTLAP PVVVSQPSNS EHKNTLDYSG  360
YKRPELYPYE RIPSQDYAKS QIRHPGPSGL VERAVSFLPI TLQIDQTTTS VSNGNGEKTE  420
TIDHSLKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098254.10.0PREDICTED: uncharacterized protein LOC105176957
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA212323