PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011097532.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 305aa    MW: 34391.8 Da    PI: 4.6591
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011097532.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-1955108356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  XP_011097532.1  55 KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 108
                     556899***********************************************9 PP

2HD-ZIP_I/II129.51.4e-4155145292
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     kkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++yd lk + e+L++++e+L +e+ 
  XP_011097532.1  55 KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDGLKLNFEKLQHDNEALLKEIG 145
                     9*************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.22E-1941112IPR009057Homeodomain-like
PROSITE profilePS5007117.28150110IPR001356Homeobox domain
SMARTSM003891.2E-1753114IPR001356Homeobox domain
CDDcd000863.66E-1755111No hitNo description
PfamPF000462.1E-1655108IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.9E-2057117IPR009057Homeodomain-like
PRINTSPR000318.4E-68190IPR000047Helix-turn-helix motif
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PRINTSPR000318.4E-690106IPR000047Helix-turn-helix motif
PfamPF021835.7E-17110151IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MKRLSSSDSL GALMSICPNS TDEHNNPMYT REFQTMMEGL DEEGCVEESG HVSDKKRRLS  60
VDQVKALEKN FEVENKLEPE RKVKLAQELG LQPRQVAVWF QNRRARWKTK QLERDYGVLK  120
ANYDGLKLNF EKLQHDNEAL LKEIGELKSK LNQDGNSESK VSDAEVKSKH ETQLKENGTE  180
ISFETLNGDS NGGIPTRGVS VFGDFKDGSS DSDSSAILNE DNNNSPHQFL DIQNGSNSIS  240
FQFCSESKPG ETTTAIAGLG EAHKNYHTQF VKIEEHNFFG EESCTSFFTD DQAPTLPWYC  300
SDDWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102110RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function as a negative regulator of the flowering time response to photoperiod. May act to repress cell expansion during plant development. {ECO:0000269|PubMed:14623244}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011097532.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097532.10.0homeobox-leucine zipper protein ATHB-6
SwissprotQ940J12e-70ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A2G9GU241e-134A0A2G9GU24_9LAMI; Transcription factor HEX
STRINGXP_004288161.11e-118(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.19e-72homeobox protein 6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]