PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011097460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 341aa    MW: 37095.3 Da    PI: 8.8313
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011097460.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-393594362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +  lkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk++
  XP_011097460.1 35 DPPLKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKMK 94
                    6679*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.0E-333792IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-263892IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4323892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MMSPDNKPAA TKPGGKDESQ SSNAARKAAS SRPQDPPLKC PRCDSPNTKF CYYNNYSLTQ  60
PRHFCKTCRR YWTKGGALRN VPIGGGCRKN KKMKSSPRLS CDSKDSSGSS DVGGLKFFQG  120
IAPAMDFQLG GAGISFPARL NTSPNTTGLY NQFSSFGEIS NTCGAISSTP CFNLDSSVIG  180
FNSTTFPNFK QGDQGNMNSP GFHQELGSMN IHSSLASSIE SLSSINQDLH WKLQQQRLSM  240
LFVGDHTQKT NTNLPISLDQ TLVQKPQPIL FQNLEISKPQ ESCRIGTTKE SGNLSTEWFF  300
DNSYASVAPT PATSSSNVNE NTSNWSGIQA WSDLSQYSSL P
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011097460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097460.10.0dof zinc finger protein DOF5.7-like
TrEMBLA0A2G9HTB51e-141A0A2G9HTB5_9LAMI; Uncharacterized protein
STRINGEOX918921e-139(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.15e-51Dof family protein