PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011097193.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 270aa    MW: 29176.7 Da    PI: 6.7133
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011097193.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26063.94.1e-2020942599
          DUF260 25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                    +q++++ +++k++G++ +++l++a p + r+++++sl+yeA+ r+ +P+yG+vg+++++++ql+q ++e++l ++
  XP_011097193.1 20 SQANATVFLAKFYGRAGLMNLINAGPSHLRPAIFRSLLYEACGRIVNPIYGSVGLMWSGSWQLCQNAVEAVLKGA 94
                    688999**************************************************************9998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.759196IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-142089IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVVEFCGRGA GGTATAGLDS QANATVFLAK FYGRAGLMNL INAGPSHLRP AIFRSLLYEA  60
CGRIVNPIYG SVGLMWSGSW QLCQNAVEAV LKGAPITQIA TDAAAAKNGP PLKAYDIRHV  120
NKEENLNDLH RVRNRCRFKR SAPKSKRSRV RVESAEETSH DEVNRTSPSH ESSLSHQSET  180
TEPVVERISG QSESLGSAET AEAEADHGVG VEPNFNTDHR LANDDEIELD LTLGLEPMKR  240
SPKPKRRQAG DSADNGGLCK MELALECPAS
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011097193.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099556.11e-121LOB domain-containing protein 41
SwissprotQ9M8861e-70LBD41_ARATH; LOB domain-containing protein 41
TrEMBLA0A2G9HGD51e-104A0A2G9HGD5_9LAMI; Uncharacterized protein
STRINGMigut.L00314.1.p1e-104(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8862494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.12e-68LOB domain-containing protein 41