PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096681.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YA
Protein Properties Length: 202aa    MW: 22529.2 Da    PI: 9.3948
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096681.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.42.1e-32107163158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep++VNaKQy++I++RRq+Rak+e e+kl +ksrkpylheSRh hAlrR+Rg gGrF
  XP_011096681.1 107 EEPVFVNAKQYHGIMRRRQSRAKAELENKL-AKSRKPYLHESRHLHALRRARGLGGRF 163
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.3E-35105166IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.767106166IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.9E-27108163IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.4E-23109131IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860111131IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.4E-23140163IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MTSSVHSFSD NSEADEQQKP SSPANGMSHP GIASPTMHYA GPAQLGVGNV MGAQTAYPYP  60
DPYYRSIFAP YETQPYPAQP YPSQPMVHLQ LMGIQQAGVP LPSEAVEEPV FVNAKQYHGI  120
MRRRQSRAKA ELENKLAKSR KPYLHESRHL HALRRARGLG GRFQKKSEDQ KKEVESSEKP  180
QDNRNLNSEM DDSKKMPPAD VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-20106163158NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096680.11e-148PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_011096681.11e-148PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP12e-58NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A022PS071e-114A0A022PS07_ERYGU; Uncharacterized protein
STRINGVIT_10s0003g04650.t019e-96(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.24e-44nuclear factor Y, subunit A7