PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096259.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 293aa    MW: 32239.9 Da    PI: 7.8183
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096259.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.11.3e-3544100359
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                     ++ lkcprC stntkfCyynny+ sqPr+fCk+C+r+WtkGG+lrnvPvGggr++++
  XP_011096259.1  44 SEPLKCPRCASTNTKFCYYNNYNKSQPRHFCKSCKRHWTKGGTLRNVPVGGGRKNKR 100
                     6789***********************************************976655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-2342100IPR003851Zinc finger, Dof-type
PfamPF027013.7E-314699IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.39147101IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104985IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGLSSKQVSG DQGLDWGRTL LQSGTAELSK SPSIRRQQPL HQSSEPLKCP RCASTNTKFC  60
YYNNYNKSQP RHFCKSCKRH WTKGGTLRNV PVGGGRKNKR PKIISKVATT TSATTVPLPT  120
TTLQQEFPNF LSTGDQKRIP EIVYQALIRS SSPLLHETTD GMSISIPEKL FMGSNGTNTI  180
SSTGLNVSAP QNSNTEFQFS SLSTFDMNAS LIPTSYQSLN YTYDHNYGGN LDSLEESSIT  240
TVNIPSTSSV PWPGPDSMSP MDLPNCWNWN EIDALTSADL NISWDDDVAE TKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096259.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A022QJ282e-81A0A022QJ28_ERYGU; Uncharacterized protein
STRINGVIT_00s0652g00010.t015e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-29DOF zinc finger protein 1