PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 726aa    MW: 79594 Da    PI: 5.8493
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096101.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.7e-2058113156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++e+e++F+++++p+ ++r+eL ++lgL+  qVk+WFqN+R+++k
  XP_011096101.1  58 KKRYHRHTQHQIQEMESFFNECPHPDDKQRKELGRRLGLEPLQVKFWFQNKRTQMK 113
                     688999***********************************************998 PP

2START222.41.4e-692464671206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++el+++a+ +ep+W  s     e + ++e++++f+++ +      ++ea+r+s+vv+m++ +lve+l+d++ qW+  +     +a tl
  XP_011096101.1 246 ELAVAAMEELIRMAQTGEPLWIPSTdnsaEVLSEEEYVRTFPRGIGpkplgLKSEASRESAVVIMNHINLVEILMDVN-QWSSVFSsivsRAVTL 339
                     57899******************9988889999**********999********************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     ev+s+g      galq+m+ae+q++splvp R+ +fvRy++q+++g+w++vdvS+d+ q p    s+ R++++pSg+li++++ng+skvtwvehv
  XP_011096101.1 340 EVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQHTDGTWAVVDVSLDNLQRPA---SISRCRRRPSGCLIQELPNGYSKVTWVEHV 431
                     ************************************************************97...7***************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++r +h+++r+lv+sgla+gak+wvatl+rqce+
  XP_011096101.1 432 EVDDRAVHSIYRPLVNSGLAFGAKRWVATLDRQCER 467
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.76E-1942115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-2143113IPR009057Homeodomain-like
PROSITE profilePS5007116.48755115IPR001356Homeobox domain
SMARTSM003892.1E-1856119IPR001356Homeobox domain
CDDcd000865.10E-1858116No hitNo description
PfamPF000462.0E-1758113IPR001356Homeobox domain
SuperFamilySSF559615.95E-39237469No hitNo description
PROSITE profilePS5084847.98237470IPR002913START domain
CDDcd088751.06E-132241466No hitNo description
SMARTSM002341.2E-69246467IPR002913START domain
PfamPF018523.8E-58247467IPR002913START domain
Gene3DG3DSA:3.30.530.201.2E-7343467IPR023393START-like domain
SuperFamilySSF559613.02E-25487718No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MFQPNLFESH HHLLDMGHKT PENEMDLIRD DEYESKSGTD IMEAPSGDDQ DPNQRPKKKR  60
YHRHTQHQIQ EMESFFNECP HPDDKQRKEL GRRLGLEPLQ VKFWFQNKRT QMKAQHERHE  120
NSQLRAENEK LRAENIRYKE ALSNATCPNC GGPAAIGEMS FDEQHLRIEN ARLREEIDRI  180
SGIAAKYVGK PMLSYPHLSP GGSRSLDLGV GNYGPQTGMS GEIYGAADLL RSVSGPTDAD  240
KPVIIELAVA AMEELIRMAQ TGEPLWIPST DNSAEVLSEE EYVRTFPRGI GPKPLGLKSE  300
ASRESAVVIM NHINLVEILM DVNQWSSVFS SIVSRAVTLE VLSTGVAGNY NGALQVMTAE  360
FQVPSPLVPT RENYFVRYCK QHTDGTWAVV DVSLDNLQRP ASISRCRRRP SGCLIQELPN  420
GYSKVTWVEH VEVDDRAVHS IYRPLVNSGL AFGAKRWVAT LDRQCERLAS VMANNISAGD  480
VGVISSPEGR KSMLKLAERM VMSFCTGVGA STAHTWTTLS GSGADDVRVM TRKSMDDPGR  540
PPGIVLSAAT SFWLPVPPKR VFDFLRDENS RSEWDILSNG GLVQEMAHIA NGRDPGNSVS  600
LLRVNSANSS QSNMLILQES STDSTASYVI YAPVDIVAMN VVLSGGDPDY VALLPSGFAI  660
LPDGPTNQAG GAPEVGSGGS LLTVAFQILV DSVPTAKLSL GSVATVNSLI KCTVERIKGA  720
VLCENA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096101.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_011096102.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_011096103.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLA0A022QKL80.0A0A022QKL8_ERYGU; Uncharacterized protein
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein