PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011095829.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NAC
Protein Properties Length: 339aa    MW: 38387.6 Da    PI: 4.8534
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011095829.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.68.4e-5661331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yL +k++g  +el evi+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat+sgyWkatgkd++v+
  XP_011095829.1   6 LPPGFRFHPTDEELVAYYLDRKINGGIIEL-EVIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATRSGYWKATGKDRAVH 99 
                     79***************************9.99**************96435566888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s +++ vg+kktLv+y+grap+g +tdWvmheyrl
  XP_011095829.1 100 S-QKRSVGMKKTLVYYRGRAPHGIRTDWVMHEYRL 133
                     *.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-633158IPR003441NAC domain
PROSITE profilePS5100560.7016158IPR003441NAC domain
PfamPF023653.2E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGPMTLPPGF RFHPTDEELV AYYLDRKING GIIELEVIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRSGYWK ATGKDRAVHS QKRSVGMKKT LVYYRGRAPH  120
GIRTDWVMHE YRLIESASAT TAGSSLKDSY ALCRVFKKNI VLPKTSRQQS VGATVDQLLW  180
DDNIGATPET SRDQREDADE DNIIKHPEVC SKNPSEASSS DLTQGTPIAV GSKDDSPAQI  240
TSDEVNSSID QFYCYGTDIN LSNFIQDYSG LFYETLYPPL SLDDFPQVDL IEAKSNNEYV  300
ASDRLRECLN GITTLEEIYS QCSSHENINY HSTYNAGSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-58415915166NO APICAL MERISTEM PROTEIN
1ut4_B1e-58415915166NO APICAL MERISTEM PROTEIN
1ut7_A1e-58415915166NO APICAL MERISTEM PROTEIN
1ut7_B1e-58415915166NO APICAL MERISTEM PROTEIN
3swm_A1e-58415918169NAC domain-containing protein 19
3swm_B1e-58415918169NAC domain-containing protein 19
3swm_C1e-58415918169NAC domain-containing protein 19
3swm_D1e-58415918169NAC domain-containing protein 19
3swp_A1e-58415918169NAC domain-containing protein 19
3swp_B1e-58415918169NAC domain-containing protein 19
3swp_C1e-58415918169NAC domain-containing protein 19
3swp_D1e-58415918169NAC domain-containing protein 19
4dul_A1e-58415915166NAC domain-containing protein 19
4dul_B1e-58415915166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011095829.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095829.10.0NAC transcription factor 29
SwissprotQ9FFI54e-86NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A2G9FZG51e-167A0A2G9FZG5_9LAMI; Uncharacterized protein
STRINGMigut.M01499.1.p1e-157(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-102NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]