PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011094442.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 237aa    MW: 27495 Da    PI: 6.5281
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011094442.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.9e-2072124456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + ++++eqle Le+ F+++ +++ +++ +LA++lgL+ rq+ vWFqNrRa++k
  XP_011094442.1  72 KKRLSTEQLESLENSFQEEIKLDPDRKMKLARELGLQPRQIAVWFQNRRARWK 124
                     55699***********************************************9 PP

2HD-ZIP_I/II121.73.6e-3971161292
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     kk+rls+eq+++LE+sF+ee kL+p+rK++lareLglqprq+avWFqnrRAR+k kqlE+ y+aLk+++da+++e+++L++ev +Lr+ lk
  XP_011094442.1  71 KKKRLSTEQLESLENSFQEEIKLDPDRKMKLARELGLQPRQIAVWFQNRRARWKGKQLERLYDALKQEFDAVSREKHKLQQEVLALRAILK 161
                     9**************************************************************************************8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-2048127IPR009057Homeodomain-like
PROSITE profilePS5007117.03866126IPR001356Homeobox domain
SMARTSM003896.1E-1869130IPR001356Homeobox domain
CDDcd000862.09E-1671127No hitNo description
PfamPF000464.6E-1772124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.6E-2173133IPR009057Homeodomain-like
PRINTSPR000317.9E-697106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000317.9E-6106122IPR000047Helix-turn-helix motif
PfamPF021831.7E-7126160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MDWNANLRVP NFVSRPDNSL SFLYNYNYND QFPAGLEIKQ PTMQSSTQHT MLPTFMEKSN  60
SSMNIYGQDP KKKRLSTEQL ESLENSFQEE IKLDPDRKMK LARELGLQPR QIAVWFQNRR  120
ARWKGKQLER LYDALKQEFD AVSREKHKLQ QEVLALRAIL KDQVAKKQVS TGYTEVISGE  180
ETVESTSIPS SDNTPAPPEN VPHHQIPECN YVFNVEDYNQ VMMTPTPYNW PPLPSCP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKGKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094442.11e-178PREDICTED: putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR03e-53ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLS8D9W81e-102S8D9W8_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc09g008810.2.17e-86(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38692246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.12e-54homeobox 51