PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093958.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 696aa    MW: 77524 Da    PI: 6.9435
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093958.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.81e-23127227198
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++ +k+a+e+       +  ++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +
  XP_011093958.1 127 FCKILTASDTSTHGGFSVLRKHANEClppldmtQ--QTPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RGD 217
                     99****************************9643..445569************************************************..348 PP

                     EE..EEEEE- CS
              B3  89 efelvvkvfr 98 
                     ++el+v+v+r
  XP_011093958.1 218 NGELRVGVRR 227
                     9999****98 PP

2Auxin_resp1041.9e-34253332183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+++ +svGmRfkm+fe+eds+err++Gt+vgv d+++ +W+nS WrsLk
  XP_011093958.1 253 ASHAITTQTLFVVYYKPRT--SQFIIGLNKYLEAMQHGFSVGMRFKMRFEGEDSPERRFTGTIVGVGDFSS-QWTNSTWRSLK 332
                     789***************6..9**********************************************888.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.06E-41114256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.9E-41119242IPR015300DNA-binding pseudobarrel domain
CDDcd100178.16E-21125227No hitNo description
PfamPF023621.2E-21127227IPR003340B3 DNA binding domain
SMARTSM010193.5E-22127229IPR003340B3 DNA binding domain
PROSITE profilePS5086312.139127229IPR003340B3 DNA binding domain
PfamPF065071.7E-32253332IPR010525Auxin response factor
PfamPF023092.5E-7564617IPR033389AUX/IAA domain
SuperFamilySSF542771.57E-14572657No hitNo description
PROSITE profilePS5174527.366581673IPR000270PB1 domain
PfamPF023092.9E-7627670IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MAHADALTAP PSHQTGLGSD DLYTELWKAC AGPLVAVPRK GERVYYFPQG HMEQLEASTN  60
QELNLQIPRF NLPSKILCRV VYIQLLAEPE TDEVYAQITL HPEPDQAEPT SLDPSPPDPP  120
KQTVHSFCKI LTASDTSTHG GFSVLRKHAN ECLPPLDMTQ QTPTQDLVAK DLHGYEWRFK  180
HIFRGQPRRH LLTTGWSTFV TSKRLVAGDS FVFLRGDNGE LRVGVRRLAR QQSSMPPSVI  240
SSQSMHLGVL ATASHAITTQ TLFVVYYKPR TSQFIIGLNK YLEAMQHGFS VGMRFKMRFE  300
GEDSPERRFT GTIVGVGDFS SQWTNSTWRS LKVQWDEPAS ILRPERVSPW DIEPFVASAS  360
VDVPQPAIKI KRPRPLDLPL TETTTPSAAS PLWYPKSTTS IELSHLTSTN DVQSSENQIF  420
WPPKQKDVNS SLPCSRAHPG GVWPSTSQMN SSLSLFRESI EDNKNVAVRS VLPDFQSPVS  480
SRASNCLDQV EGIKRLEAAS ACRLFGIDLR NNSNKVPPVG KEVSFPRANI IPDCDATIKK  540
SEADGMQSVD LLNSSKERKH VQTEVSPNDM QSKLSLGSSS RTRIKVQMQG IAVGRGVDLT  600
AFGGYDDLIS ELENMFEIKG ELRPRNKWEV VYTDNEGDMM LVGDDPWPEF CKMAKKICIY  660
SSEEVKKMTP KCKLPLSSLD GEGRILSLES QPTLEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1801635513355Auxin response factor 1
4ldw_A1e-1801635513355Auxin response factor 1
4ldw_B1e-1801635513355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1370374KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011093958.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0367384e-38KX036738.1 Salvia miltiorrhiza auxin response factor ARF18 (ARF) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093958.10.0auxin response factor 18 isoform X2
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A2G9I4690.0A0A2G9I469_9LAMI; Auxin response factor
STRINGPGSC0003DMT4000003450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]