PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093784.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YA
Protein Properties Length: 305aa    MW: 34017.7 Da    PI: 7.9141
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093784.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.22.8e-33156212158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     d p+YVNaKQy++Il+RRq+Rakle+++kl  k+rkpylheSRh+hAl+R RgsgGrF
  XP_011093784.1 156 DGPIYVNAKQYHGILRRRQTRAKLEAQNKL-VKTRKPYLHESRHQHALNRVRGSGGRF 212
                     57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.2E-37154215IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.201155215IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.8E-24158180IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.1E-28158212IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860160180IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.8E-24189212IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MANLHEQHFP QTVSKNLSFE VDYSAQRDLE VKHISFQLQD QHSSSTESTG LSHQEQTAMG  60
KTSSQDQCAS SDSVHDDSYG KHGQDMKAAM FLCNPELSIN ASQPEISQPI VHFPYAYSDP  120
YLSGLFTPYG PHNMIQPQVM ASASGRVPLP ADLPEDGPIY VNAKQYHGIL RRRQTRAKLE  180
AQNKLVKTRK PYLHESRHQH ALNRVRGSGG RFLSTKKSQQ PESLPPSQTT PDSFHFGNML  240
NSSEHRFEAN KHDTAPTTSR VPDSDSILQQ PDGRFPSLPS HMAVPMQGSG SLVYNGNRHY  300
ASIVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-23158231477NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093783.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_011093784.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A022QE291e-106A0A022QE29_ERYGU; Uncharacterized protein
STRINGPOPTR_0006s14740.15e-92(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.14e-43nuclear factor Y, subunit A3