PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093715.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 267aa    MW: 28867.3 Da    PI: 8.3989
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093715.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.1e-13110154347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
   XP_011093715.1 110 PWTEEEHRTFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 154
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.76103159IPR017930Myb domain
SuperFamilySSF466891.27E-17105158IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-18106158IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-11107153IPR009057Homeodomain-like
SMARTSM007171.4E-9107157IPR001005SANT/Myb domain
CDDcd001671.03E-8110155No hitNo description
PfamPF002496.3E-11110154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCNF LSRGPNAAGG AVMRLFGVQL DISSSPSIPM KKSFSLDCLS  60
SAPPLLSSSP SSSLSSSCVP IHEHPDKASI GYLSDGPLGP RPSERKKGVP WTEEEHRTFL  120
IGLEKLGKGD WRGISRNFVT TRTPTQVASH AQKYFLRQAC VHKKKRRSSL FDMVGGSDHH  180
NAGSETVSTD PKGDVRIDLN SFEDIEEDRK SNGQEWGEHF IWPNPNSPNA APELELTLSS  240
SAAPPTTMGK HESSSSTSLL MGPISVT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162166KKKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011093715.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093715.10.0transcription factor KUA1-like
SwissprotQ7XC572e-47MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLA0A2G9I6689e-91A0A2G9I668_9LAMI; Uncharacterized protein
STRINGMigut.J00595.1.p1e-87(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33852147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.18e-55MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]