PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 373aa    MW: 41055.5 Da    PI: 6.0947
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093390.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-18208262256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq   Lee F+++++p+ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_011093390.1 208 RKKLRLTKEQSAFLEESFKEHNTPNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 262
                     788899***********************************************98 PP

2HD-ZIP_I/II124.16.5e-40208298192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rl+keq+++LEesF+e+++ +p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  XP_011093390.1 208 RKKLRLTKEQSAFLEESFKEHNTPNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 298
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-19198265IPR009057Homeodomain-like
PROSITE profilePS5007117.831204264IPR001356Homeobox domain
SMARTSM003891.4E-16206268IPR001356Homeobox domain
PfamPF000463.8E-16208262IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-18208262IPR009057Homeodomain-like
CDDcd000861.01E-16208265No hitNo description
PROSITE patternPS000270239262IPR017970Homeobox, conserved site
SMARTSM003401.0E-25264307IPR003106Leucine zipper, homeobox-associated
PfamPF021835.8E-11264298IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MELGLSLGDA TKPFGFLKEN NTQKQQNAAI SKKSGLDFCI ALGLSSSTVG DGDREKTQRS  60
QEDDDEDDDD DDDQSSEGDG SDDTQGETHL QLNLRPLAPV HRRVSPRLLS LPWSSDNGSS  120
ENGSSGNMGL PAAKGFDVNR LPAAAEEVSS ANSVGSPFQR DFGMYRRPGN GNLGGSKRDF  180
EATGNDVVEA ERASSRASDD DENGLNTRKK LRLTKEQSAF LEESFKEHNT PNPKQKLALA  240
KQLNLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRCCETL TEENRRLHKE LQELRALKTS  300
NPFYMQSPAT TLTMCPSCER VATTTTTTTA PPPVSAASGK MAPIPKAIPF PLTRPRFFPF  360
PQTPTHPNQP AAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1206212TRKKLRL
2256264RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011093390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0729507e-60KJ072950.1 Sesamum indicum clone TilSSR_44151 microsatellite Sesame_44151 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093390.10.0homeobox-leucine zipper protein HOX11-like
SwissprotP466651e-85HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2G9I6090.0A0A2G9I609_9LAMI; Transcription factor HEX
STRINGXP_009617361.11e-145(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-68homeobox from Arabidopsis thaliana