PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YA
Protein Properties Length: 310aa    MW: 34086.6 Da    PI: 9.9647
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093324.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.33.9e-31143199158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq+Ra++e +kkl  k+rkpylheSRh+hA+rR+RgsgGrF
  XP_011093324.1 143 EEPVYVNAKQYRGILRRRQMRARAELDKKL-VKNRKPYLHESRHQHAIRRARGSGGRF 199
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.9E-36141202IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.332142202IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-26144199IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-22145167IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-22176199IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MPALAKSSDQ QLETGLRSIP NSTFYSQPWW QGLGHNGMPS GGQQEDGPVG PATLQPQGTG  60
EGASKDPEIN AALRSGLNGS NNGQEKQHLD ANSQMELVGH SIMLTPYPYE DPQYGGRLTY  120
GATVHHLLGY HPARMPLPLE MEEEPVYVNA KQYRGILRRR QMRARAELDK KLVKNRKPYL  180
HESRHQHAIR RARGSGGRFL NTKKLDGSGK NSTSGEQPKS GEITHTQSSS PASAHLSYNR  240
NNISNQQGNG ASTIQGTHKK QNLPNGFSHG NGLALYYADS TRRDLENDHF SEDNRTSLVS  300
TAPQGPSFRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-18143206265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093323.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_011093324.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
TrEMBLA5PGU23e-90A5PGU2_ANTMA; YA3
STRINGPGSC0003DMT4000176986e-80(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.41e-37nuclear factor Y, subunit A1