PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093307.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 648aa    MW: 72955.3 Da    PI: 4.6068
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093307.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.71.7e-10499540346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW++++ el+++av+q+G++  + I + ++  Rt+ q+k+++ k
   XP_011093307.1 499 RWSKQDTELFYEAVRQFGTD-LSMIQQLFP-DRTRRQVKLKYKK 540
                      8*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.4E-27492573No hitNo description
PROSITE profilePS512939.091495543IPR017884SANT domain
SMARTSM007172.7E-7496544IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-5499540IPR009057Homeodomain-like
CDDcd001677.69E-7499540No hitNo description
SuperFamilySSF466893.51E-10499546IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MGIDLDPLDD IFADEAVKNA RAVGKFQPKS KFRPPRKDAA ATSLSSSQAA QTIDPAQSES  60
SDPRRRAESS EKVISGLDVV SNYDGGWHAS IEKSVTENAD IFIGLEALGD FLPHTTTDMA  120
AVDPVTAGKP IVSSSDGCGR MHDKELGREE MDIMDSINAS EFTTNSGHRT GKFQPKPKLQ  180
MHEVKPAESL SCSLGSQSVP PEISYAEKDF SPTFQQDDVL DLSSLGFTHT LPTEASSELP  240
LNEESMNLTE MTQLDSGIPL ECPPEIPAKL ASRRAKIGRN KTQTALDPSQ QQQKTSTSCQ  300
ENEMGRSLRP RKSKTNFCEL GDEVEDVVRA SEEFSEECPV NSAAEEETVN NEEFQVESDS  360
QMKKVKQKFE KPVRKRKETE ASDKDAKPKK FSHSTRRRRV DKVLLATPED EIEYQKVPLR  420
DLILLAEHKE REMKKEEAGA GVTANKQSNG NSSSRYNQEE TFTSEQNGEY NDGQGSPRIE  480
ESPIYFNYHT HMDRTPSIRW SKQDTELFYE AVRQFGTDLS MIQQLFPDRT RRQVKLKYKK  540
EERQHPLRLR EALTNRTKDH SHFEKVIERL KQIAAEENQN ADNDESIDLT GNEVDEGTLN  600
AGDEEAKDEH IDEEVNENVE NDFTEVQSPS KSEDIEDDLF IWSQYKSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1370376KPVRKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011093307.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020553620.10.0transcription factor TFIIIB component B''-like isoform X3
TrEMBLA0A2G9GU170.0A0A2G9GU17_9LAMI; Uncharacterized protein
STRINGMigut.F00900.1.p0.0(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-46MYB_related family protein