PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093304.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 678aa    MW: 75941.6 Da    PI: 4.6606
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093304.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.61.8e-10529570346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW++++ el+++av+q+G++  + I + ++  Rt+ q+k+++ k
   XP_011093304.1 529 RWSKQDTELFYEAVRQFGTD-LSMIQQLFP-DRTRRQVKLKYKK 570
                      8*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.5E-27522603No hitNo description
PROSITE profilePS512939.091525573IPR017884SANT domain
SMARTSM007172.7E-7526574IPR001005SANT/Myb domain
CDDcd001675.81E-7529570No hitNo description
Gene3DG3DSA:1.10.10.603.0E-5529570IPR009057Homeodomain-like
SuperFamilySSF466893.66E-10529576IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MGIDLDPLDD IFADEAVKNA RAVGKFQPKS KFRPPRKDAA ATSLSSSQAA QTIDPAQSES  60
SDPRRRAESS EKVISGLDVV SNYDGGWHAS IEKSVTENAD IFIGLEALGD FLPHTTTDMG  120
GGPAPVISSV GDSTHRCKVA DVPKCHELSA AVDPVTAGKP IVSSSDGCGR MHDKELGREE  180
MDIMDSINAS EFTTNSGHRT GKFQPKPKLQ MHEVKPAESL SCSLGSQSVP PEISYAEKDF  240
SPTFQQDDVL DLSSLGFTHT LPTEASSELP LNEESMNLTE MTQLDSGIPL ECPPEIPAKL  300
ASRRAKIGRN KTQTALDPSQ QQQKTSTSCQ ENEMGRSLRP RKSKTNFCEL GDEVEDVVRA  360
SEEFSEECPV NSAAEEETVN NEEFQVESDS QMKKVKQKFE KPVRKRKETE ASDKDAKPKK  420
FSHSTRRRRV DKVLLATPED EIEYQKVPLR DLILLAEHKE REMKKEEAGA GVTANKQSNG  480
NSSSRYNQEE TFTSEQNGEY NDGQGSPRIE ESPIYFNYHT HMDRTPSIRW SKQDTELFYE  540
AVRQFGTDLS MIQQLFPDRT RRQVKLKYKK EERQHPLRLR EALTNRTKDH SHFEKVIERL  600
KQIAAEENQN ADNDESIDLT GNEVDEGTLN AGDEEAKDEH IDEEVNENVE NDFTEVQSPS  660
KSEDIEDDLF IWSQYKSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1400406KPVRKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011093304.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093303.10.0transcription factor TFIIIB component B''-like isoform X1
TrEMBLA0A2G9GU170.0A0A2G9GU17_9LAMI; Uncharacterized protein
STRINGMigut.F00900.1.p0.0(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-46MYB_related family protein