PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093167.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 834aa    MW: 91060.3 Da    PI: 6.1877
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093167.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.7e-21138193156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  XP_011093167.1 138 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 193
                     688999***********************************************999 PP

2START204.35e-643435691206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                     ela++a++elvk+a+ +e++W +s     e++n +e++++f++           + +ea+r++g+v+ ++  lve+l+d++ +W e+++    + 
  XP_011093167.1 343 ELALAAMDELVKMAQTDEALWLRSFeggrEILNHEEYVRTFST--PcigmkpngFVTEASRETGMVIINSLALVETLMDSN-KWAEMFPciiaRT 434
                     5899*********************9***************66..3459999999**************************.************* PP

                     EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEE CS
           START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtw 166
                     +t++vis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +  s+ +  +++lpSg+++++++ng+skvtw
  XP_011093167.1 435 ATTDVISNGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGgSPTYPNCRRLPSGCVVQDMPNGYSKVTW 529
                     ***************************************************************999***************************** PP

                     EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     veh++++++++h l+rsl++ g+ +ga++wvatlqrqce+
  XP_011093167.1 530 VEHAEYDESVVHHLYRSLISAGMGFGAQRWVATLQRQCEC 569
                     **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-20121195IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-22124195IPR009057Homeodomain-like
PROSITE profilePS5007117.216135195IPR001356Homeobox domain
SMARTSM003899.9E-18136199IPR001356Homeobox domain
CDDcd000861.36E-18137195No hitNo description
PfamPF000461.4E-18138193IPR001356Homeobox domain
PROSITE patternPS000270170193IPR017970Homeobox, conserved site
PROSITE profilePS5084843.716334572IPR002913START domain
SuperFamilySSF559611.65E-33336569No hitNo description
CDDcd088752.57E-124338568No hitNo description
PfamPF018522.1E-55343569IPR002913START domain
SMARTSM002341.0E-49343569IPR002913START domain
SuperFamilySSF559613.3E-23597827No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MNFGDFLDHN NSCGGGGARI VADLPYSNSS SNNNTIGTNP SGNINSNNDM PTGAIAQPRL  60
VPQPLSTKPM FNSPGLSLAL QTSMEGQGEM ARMGENYETS NVGGRRSRDE EHESRSGSDN  120
MEGASGDDQD ASDKPPRKKR YHRHTPQQIQ ELEALFKECP HPDEKQRLEL SKRLCLETRQ  180
VKFWFQNRRT QMKTQLERHE NSILRQENDK LRAENMSMRE AMRNPICTNC GGPAMIGEIS  240
LEEQHLRIEN ARLKDELDRV CALAGKFLGR PVSSLAAPPM PNSSLELGVG SNGFGGGLNT  300
VIPTTLPLGP TDYGSSLPVM PPTKATMNIA PIERSLERSM YLELALAAMD ELVKMAQTDE  360
ALWLRSFEGG REILNHEEYV RTFSTPCIGM KPNGFVTEAS RETGMVIINS LALVETLMDS  420
NKWAEMFPCI IARTATTDVI SNGMGGTRNG ALQLMHAELQ VLSPLVPVRE VNFLRFCKQH  480
AEGVWAVVDV SIDTIRETSG GSPTYPNCRR LPSGCVVQDM PNGYSKVTWV EHAEYDESVV  540
HHLYRSLISA GMGFGAQRWV ATLQRQCECL AILMSSNVPT RDHTAITAGG RRSMLKLAQR  600
MTNNFFAGVC ASTVHKWNKL RTENVDEDVR VMTRKSVDDP GEPPGIVLSA ATSVWLPVTP  660
QRLFDFLRNE HLRSEWDILS NGGPMQEMAH IAKGQDHGNC VSLLRASAMN ANQSSMLILQ  720
ETCIDAAGSL VVYAPVDIPA MHVVMNGGDS AYVALLPSGF AIVPDGPGSR GGDDGPTSNG  780
GPGHRVSGSL LTVAFQILVN SLPTAKLTVE SVETVNNLIS CTVQKIKAAL QCES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093167.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK4AZA30.0K4AZA3_SOLLC; Uncharacterized protein
STRINGSolyc01g091630.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein