PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093166.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 835aa    MW: 91188.4 Da    PI: 6.1877
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093166.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.7e-21139194156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  XP_011093166.1 139 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 194
                     688999***********************************************999 PP

2START204.35e-643445701206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                     ela++a++elvk+a+ +e++W +s     e++n +e++++f++           + +ea+r++g+v+ ++  lve+l+d++ +W e+++    + 
  XP_011093166.1 344 ELALAAMDELVKMAQTDEALWLRSFeggrEILNHEEYVRTFST--PcigmkpngFVTEASRETGMVIINSLALVETLMDSN-KWAEMFPciiaRT 435
                     5899*********************9***************66..3459999999**************************.************* PP

                     EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEE CS
           START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtw 166
                     +t++vis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +  s+ +  +++lpSg+++++++ng+skvtw
  XP_011093166.1 436 ATTDVISNGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGgSPTYPNCRRLPSGCVVQDMPNGYSKVTW 530
                     ***************************************************************999***************************** PP

                     EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     veh++++++++h l+rsl++ g+ +ga++wvatlqrqce+
  XP_011093166.1 531 VEHAEYDESVVHHLYRSLISAGMGFGAQRWVATLQRQCEC 570
                     **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-20122196IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-22125196IPR009057Homeodomain-like
PROSITE profilePS5007117.216136196IPR001356Homeobox domain
SMARTSM003899.9E-18137200IPR001356Homeobox domain
CDDcd000861.36E-18138196No hitNo description
PfamPF000461.4E-18139194IPR001356Homeobox domain
PROSITE patternPS000270171194IPR017970Homeobox, conserved site
PROSITE profilePS5084843.716335573IPR002913START domain
SuperFamilySSF559611.65E-33337570No hitNo description
CDDcd088752.52E-124339569No hitNo description
SMARTSM002341.0E-49344570IPR002913START domain
PfamPF018522.1E-55344570IPR002913START domain
SuperFamilySSF559613.3E-23598828No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 835 aa     Download sequence    Send to blast
MNFGDFLDHN NSCGGGGARI VADLPYSNSS SNNNTIGTNP SGNINSNNDM PTGAIAQPRL  60
VPQPLSTKPM FNSPGLSLAL QQTSMEGQGE MARMGENYET SNVGGRRSRD EEHESRSGSD  120
NMEGASGDDQ DASDKPPRKK RYHRHTPQQI QELEALFKEC PHPDEKQRLE LSKRLCLETR  180
QVKFWFQNRR TQMKTQLERH ENSILRQEND KLRAENMSMR EAMRNPICTN CGGPAMIGEI  240
SLEEQHLRIE NARLKDELDR VCALAGKFLG RPVSSLAAPP MPNSSLELGV GSNGFGGGLN  300
TVIPTTLPLG PTDYGSSLPV MPPTKATMNI APIERSLERS MYLELALAAM DELVKMAQTD  360
EALWLRSFEG GREILNHEEY VRTFSTPCIG MKPNGFVTEA SRETGMVIIN SLALVETLMD  420
SNKWAEMFPC IIARTATTDV ISNGMGGTRN GALQLMHAEL QVLSPLVPVR EVNFLRFCKQ  480
HAEGVWAVVD VSIDTIRETS GGSPTYPNCR RLPSGCVVQD MPNGYSKVTW VEHAEYDESV  540
VHHLYRSLIS AGMGFGAQRW VATLQRQCEC LAILMSSNVP TRDHTAITAG GRRSMLKLAQ  600
RMTNNFFAGV CASTVHKWNK LRTENVDEDV RVMTRKSVDD PGEPPGIVLS AATSVWLPVT  660
PQRLFDFLRN EHLRSEWDIL SNGGPMQEMA HIAKGQDHGN CVSLLRASAM NANQSSMLIL  720
QETCIDAAGS LVVYAPVDIP AMHVVMNGGD SAYVALLPSG FAIVPDGPGS RGGDDGPTSN  780
GGPGHRVSGS LLTVAFQILV NSLPTAKLTV ESVETVNNLI SCTVQKIKAA LQCES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093166.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK4AZA30.0K4AZA3_SOLLC; Uncharacterized protein
STRINGSolyc01g091630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein