PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093085.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 317aa    MW: 35210.7 Da    PI: 9.4507
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093085.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14.2e-1368112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W+++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   XP_011093085.1  68 RESWSEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 112
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.36E-1662118IPR009057Homeodomain-like
PROSITE profilePS5129414.96663117IPR017930Myb domain
TIGRFAMsTIGR015574.8E-1866115IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.9E-667108IPR009057Homeodomain-like
SMARTSM007171.1E-1067115IPR001005SANT/Myb domain
PfamPF002495.7E-1168112IPR001005SANT/Myb domain
CDDcd001673.89E-870113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MVSVYPNPPP DQNFTYFYSY MGGDPMKIPG VNRSDGHLLQ ATAIGNVGSA VDDTNKKIRK  60
PYTITKSRES WSEQEHDKFL EALQLFDRDW KKIEAFVGSK TVIQIRSHAQ KYFLKVQKNG  120
TSEHVPPPRP KRKAAHPYPQ KAQKNATGVL QPSAALESGY AVRPDSLLIP RKTIGNAPVP  180
SWTYNAVPTG CLSHISKDDT GLANNYSSSS NESTHRVWTS DGTQGNLKVE QYNTARVMPD  240
FAQVYHFIGS VFDPCASDHL QRLKKMEPIN VETVLMLMKN LAVNLVSPEF EDHRRLLSSY  300
TGVGTESNGT GSTIPSV
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011093085.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093085.10.0protein REVEILLE 6 isoform X2
SwissprotQ8H0W38e-97RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2G9H8311e-156A0A2G9H831_9LAMI; Zuotin
STRINGXP_009617756.11e-126(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.24e-85MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]