PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011092424.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family CAMTA
Protein Properties Length: 1021aa    MW: 114178 Da    PI: 5.7574
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011092424.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1183.72.1e-57201362118
            CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                     l+ ++rwl++ ei++iL n+ek++++ e++++p sgs++L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+v++l+cyYah+e+n++fqr
  XP_011092424.1  20 LEAQHRWLRPAEICEILRNYEKFHISPEAPNKPVSGSVFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDMLHCYYAHGEDNENFQR 114
                     5679******************************************************************************************* PP

            CG-1  97 rcywlLeeelekivlvhylevk 118
                     r+ywlLe++l +iv+vhylevk
  XP_011092424.1 115 RSYWLLEQDLMHIVFVHYLEVK 136
                     *******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143782.88215141IPR005559CG-1 DNA-binding domain
SMARTSM010769.5E-8118136IPR005559CG-1 DNA-binding domain
PfamPF038599.4E-5121135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.102.1E-4434521IPR013783Immunoglobulin-like fold
PfamPF018332.0E-6436521IPR002909IPT domain
SuperFamilySSF812968.0E-16436522IPR014756Immunoglobulin E-set
PROSITE profilePS5029719.89619740IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484034.51E-17627730IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.0E-16629732IPR020683Ankyrin repeat-containing domain
CDDcd002041.80E-14632728No hitNo description
PfamPF127962.9E-6636695IPR020683Ankyrin repeat-containing domain
SMARTSM002487.4E-4669698IPR002110Ankyrin repeat
PROSITE profilePS5008810.018669701IPR002110Ankyrin repeat
SMARTSM002482100708737IPR002110Ankyrin repeat
SuperFamilySSF525401.89E-7841892IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.84841863IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.675843871IPR000048IQ motif, EF-hand binding site
PfamPF006120.0064844862IPR000048IQ motif, EF-hand binding site
SMARTSM000154.6E-4864886IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.871865889IPR000048IQ motif, EF-hand binding site
PfamPF006124.3E-5867886IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071275Biological Processcellular response to aluminum ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1021 aa     Download sequence    Send to blast
MEESGSYNLG FRLDIKQILL EAQHRWLRPA EICEILRNYE KFHISPEAPN KPVSGSVFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHEK LKVGSVDMLH CYYAHGEDNE NFQRRSYWLL  120
EQDLMHIVFV HYLEVKGNKT NLGGVRNNDR VVSNSENESS LSSSFRGTSP TSTLSSAYED  180
AESEGNHQAS SRFHSYPESP LTDDNHSAQS SSYNQLFNPG NQNVPALNYA SLLRGNRDGD  240
FGGDSLVCGA QETGDFALWQ EVLGNPTTGE IAYKPETGFS LPVQANRQAL NSLFEEKSLS  300
SDQGNDAGPF YSYPEQKGQS GENNLQMLLS DAEAGNVMNP NMENVMAAIG NENYSFLLKK  360
PLIGGLQTEE SLKKVDSFSR WMAKELGEAD GLDMQSSNGI SWSIIGNEYD SNMSAQLQVD  420
THTLNPSISQ DQLFSIIDFS PNWAYSNLDT KVLITGTFLK SEEELSNCRW SIMFGEVEVP  480
AQVLADGILC CRAPLHNPGL IPFYVTCSNR LACSEIREFE YRFGPDQNAD AVDVHGDSAI  540
LMHLYQRFET ILSLEPVGSP VSSAKNDLEK QSLVNKIISL MEENNPESKL TPNDDTSHLK  600
VIGELLLKKQ LRQIFYSWLL HRVTEDGKGL TVIDEGGQSV LHLAAALGFN WAFQPIIVSG  660
VSIDFRDVNG WTALHWAAFY GREDTVAALV SLGAAPGALT DPSAEYPRGR SPSHLASSRG  720
HKGISGFLAE TALTTHLSSL KVNDDCTKEV SGLKGILTVS ERSAVPTTEE DVPDTLSLKD  780
SLAAVCNATQ AAARIHQIFR VQSFQRKQLI EQDSDELLTP DEHAISLLAA KASRFNHSDG  840
VVNAAALQIQ KKYRGWKKRK EFLLIRQKIV KIQAHVRGHQ ARKKYKPIIW SVGILEKVIL  900
RWRRKGSGLR GFRSDAVQKG PDTPSLMPPQ EDDYDFLKEG RKQTEERMHK ELARVKSMAQ  960
YPEARAQYRR LLTAAQGFRE TKHDASDVIP DNMEDMIYPE EDLLDVASLL DDDTFMSLTF  1020
Q
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00043PBMTransfer from AT5G64220Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092424.10.0PREDICTED: calmodulin-binding transcription activator 2
SwissprotQ6NPP40.0CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLA0A068TQ040.0A0A068TQ04_COFCA; Uncharacterized protein
STRINGSolyc01g105230.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22302146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.20.0Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains