PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011091721.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 828aa    MW: 90414.9 Da    PI: 6.3006
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011091721.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.6e-21131186156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  XP_011091721.1 131 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 186
                     688999***********************************************999 PP

2START205.91.6e-643375621206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++elvk+a+ +ep+W +s     e++n +e+l++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    + +t+
  XP_011091721.1 337 ELALAAMDELVKMAQTDEPLWLRSLeggrEILNHEEYLRTFTPCIGmkpngFVTEASRETGMVIINSLALVETLMDSN-KWAEMFPciiaRTSTT 430
                     5899**************************************9988999*9***************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwveh 169
                     +vissg      galqlm+a+lq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +     +  +++lpSg+++++++ng+skvtwveh
  XP_011091721.1 431 DVISSGmggtrnGALQLMNAALQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGgPTTFPNCRRLPSGCVVQDMPNGYSKVTWVEH 525
                     ********************************************************9999998888999************************** PP

                     EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     v+++++++h+l+r+l++ g+ +ga++wvatlqrqce+
  XP_011091721.1 526 VEYDESVVHQLYRPLISAGMGFGAQRWVATLQRQCEC 562
                     ***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-20114188IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-21118188IPR009057Homeodomain-like
PROSITE profilePS5007117.216128188IPR001356Homeobox domain
SMARTSM003899.9E-18129192IPR001356Homeobox domain
CDDcd000861.34E-18130188No hitNo description
PfamPF000461.4E-18131186IPR001356Homeobox domain
PROSITE patternPS000270163186IPR017970Homeobox, conserved site
PROSITE profilePS5084843.74328565IPR002913START domain
SuperFamilySSF559616.87E-32330562No hitNo description
CDDcd088752.34E-124332561No hitNo description
PfamPF018523.8E-56337562IPR002913START domain
SMARTSM002347.2E-51337562IPR002913START domain
SuperFamilySSF559611.47E-24589821No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MNFGDFLDNN SCGGGGARIV SDIPYSNSNS NNNNAITSDI NSMPTGAIAH PRLVSHSLTT  60
KPMFNSPGLS LALQTSMEAQ GDMARMAENY ELSNVGGRRS RDEEHESRSG SDNMDGASGD  120
DQDAADKPPR KKRYHRHTPQ QIQELEALFK ECPHPDEKQR LELSKRLCLE TRQVKFWFQN  180
RRTQMKTQLE RHENSILRQE NDKLRAENLS IREAMRNPIC TNCGGPAIIG EISLEEQHLR  240
IENARLKDEL DRVCALAGKF LGRPISSLAA PMPNSSLELG VGSNGFGGLN TIPSTMPLVV  300
PSDFGMGISS PLPMVTPKAT MNISPIERSL ERSMYLELAL AAMDELVKMA QTDEPLWLRS  360
LEGGREILNH EEYLRTFTPC IGMKPNGFVT EASRETGMVI INSLALVETL MDSNKWAEMF  420
PCIIARTSTT DVISSGMGGT RNGALQLMNA ALQVLSPLVP VREVNFLRFC KQHAEGVWAV  480
VDVSIDTIRE TSGGPTTFPN CRRLPSGCVV QDMPNGYSKV TWVEHVEYDE SVVHQLYRPL  540
ISAGMGFGAQ RWVATLQRQC ECLAILMSST VPVREHTAIT GGGRRSMLKL AQRMTNNFCA  600
GVCASSVHKW NKLRTENVDD DVQVMTRKSV DDPGEPPGIV LSAATSVWLP VSPQRLFDFL  660
RDERLRSEWD ILSNGGPMQE MAHIAKGQDH GNCVSLLRAS AMNSSQSSML ILQETCIDAA  720
GSLVVYAPVD IPAMHVVMNG GDSAYVALLP SGFSIVPDGP GSRGPPSNGP TSNGGATHRV  780
SGSLLTVAFQ ILVNSLPTAK LTVESVETVN NLISCTVQKI KAALHCES
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091721.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A067JXS10.0A0A067JXS1_JATCU; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein