PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090575.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family bZIP
Protein Properties Length: 360aa    MW: 41017.7 Da    PI: 7.6621
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090575.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.16e-1174111239
                     XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                     +++k+ rr+++NReAAr+sR+RKka++++Le+    L 
  XP_011090575.1  74 PDDKVLRRLAQNREAARKSRLRKKAYVQQLENCKLRLI 111
                     689****************************8555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.8E-868119No hitNo description
SMARTSM003386.7E-873136IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.07175119IPR004827Basic-leucine zipper domain
PfamPF001701.6E-776105IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.01E-677117No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
PfamPF141444.8E-27162237IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MNSASTHFVP SRRMGIYEPI HQLPMWGDFK GNNLLDTSSP MMLEIEAKLD NQSEDTSHGT  60
VGPSNKYDQE ASKPDDKVLR RLAQNREAAR KSRLRKKAYV QQLENCKLRL IQLEEELRRA  120
RQQGLHVGGI DTSQLGYSGS INPGIATFEM EYGHWVEEQN RQISDLRNAL HSDIGDMELR  180
IFVEGGIRHY LDLFTMKATA ASADVFYIMS GLWKTPAERF FLWIGGFRPS ELLKVLLPHL  240
EPLSEQQRLD VCNLTQSCQQ AEDALSQGME KLQHILAETI ATAQLGERNY LTQIRGAIDK  300
LDALVRFVVQ ADHLRQETLQ QISRILTTRQ AARGLLALGE YMKRLRALSS CWSSRPREQP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00586DAPTransfer from AT5G65210Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011090575.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090575.10.0transcription factor TGA1
RefseqXP_011090576.10.0transcription factor TGA1
SwissprotQ392370.0TGA1_ARATH; Transcription factor TGA1
TrEMBLA0A2G9GKD20.0A0A2G9GKD2_9LAMI; Uncharacterized protein
STRINGMigut.H02410.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-159bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Herrera-Vásquez A, et al.
    Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis.
    Plant Mol. Biol. Rep., 2018.
    [PMID:26696694]
  4. Gutsche N,Zachgo S
    The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding.
    PLoS ONE, 2016. 11(4): p. e0153810
    [PMID:27128442]
  5. Sun T, et al.
    TGACG-BINDING FACTOR 1 (TGA1) and TGA4 regulate salicylic acid and pipecolic acid biosynthesis by modulating the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT 1 (SARD1) and CALMODULIN-BINDING PROTEIN 60g (CBP60g).
    New Phytol., 2018. 217(1): p. 344-354
    [PMID:28898429]