PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090094.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 190aa    MW: 20929.8 Da    PI: 5.6779
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090094.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-42301291100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+++la
  XP_011090094.1  30 PCAACKILRRRCVEKCVLAPYFPPNDPLKFTTAHRVFGASNIIKFLQELPEPQRADAVSSMVYEANARLRDPVYGCAGAICQLQKQVSELQEQLA 124
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_011090094.1 125 KARAE 129
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.24729130IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4230127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MEGSDTTITT VTSPSSSVSP PPQSHVVISP CAACKILRRR CVEKCVLAPY FPPNDPLKFT  60
TAHRVFGASN IIKFLQELPE PQRADAVSSM VYEANARLRD PVYGCAGAIC QLQKQVSELQ  120
EQLAKARAEL VNVQCQNANL MALICMEMAQ PNDHQSSLDA FGTSPRTYQS NANFLDENNT  180
GLVWEQLLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-432913510116LOB family transfactor Ramosa2.1
5ly0_B2e-432913510116LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011090094.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090094.11e-141LOB domain-containing protein 1
SwissprotQ9LQR09e-69LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A2G9GMD14e-99A0A2G9GMD1_9LAMI; Uncharacterized protein
STRINGVIT_06s0004g03350.t011e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-67LOB domain-containing protein 1