PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YA
Protein Properties Length: 316aa    MW: 34534.1 Da    PI: 7.7976
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090024.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.12.6e-32166222158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq Rak+e ekkl +k+rkpylheSRh+hA+rR+RgsgGrF
  XP_011090024.1 166 QEPVYVNAKQYHGILRRRQIRAKAELEKKL-IKARKPYLHESRHQHAMRRARGSGGRF 222
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.3E-36164225IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.491165225IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.9E-28167222IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-24168190IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860170190IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-24199222IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MQPKSKTVNQ GETNLYNGHN STLCSEPWWN STGFNSFSPA MMRGNASDSS SLEQSADGQS  60
QSEGGINEDD DETVKQSPST MPLQSDRNHR PENTNLEKGV PTLHPRPDGS LSQPPQLELV  120
GHSIACAANP YDPYFGGVVA AYGQPMVPHL YDMNQMRMPL PLEMAQEPVY VNAKQYHGIL  180
RRRQIRAKAE LEKKLIKARK PYLHESRHQH AMRRARGSGG RFAKKSDADT SKGTGSGSDV  240
SSQSINSTGS EPLLSKSSGA KAPEPQNLYD SAASNFRKQT NLQEPVYQSH SGEMGEGPAS  300
SQQWGNIPSN HALAMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-20166240276NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090024.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_011090025.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
TrEMBLA5PGU31e-155A5PGU3_ANTMA; YA4
STRINGPGSC0003DMT4000277851e-117(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.38e-55nuclear factor Y, subunit A1