PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YA
Protein Properties Length: 365aa    MW: 40175.8 Da    PI: 7.1244
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090023.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.73.3e-32215271158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq Rak+e ekkl +k+rkpylheSRh+hA+rR+RgsgGrF
  XP_011090023.1 215 QEPVYVNAKQYHGILRRRQIRAKAELEKKL-IKARKPYLHESRHQHAMRRARGSGGRF 271
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.3E-36213274IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.491214274IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.9E-28216271IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-24217239IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860219239IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.3E-24248271IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MYSFLHVNIP ACNEVSDLWF CSCLVPGFCL LMCLDSIKIG QVLWRNYESM QPKSKTVNQG  60
ETNLYNGHNS TLCSEPWWNS TGFNSFSPAM MRGNASDSSS LEQSADGQSQ SEGGINEDDD  120
ETVKQSPSTM PLQSDRNHRP ENTNLEKGVP TLHPRPDGSL SQPPQLELVG HSIACAANPY  180
DPYFGGVVAA YGQPMVPHLY DMNQMRMPLP LEMAQEPVYV NAKQYHGILR RRQIRAKAEL  240
EKKLIKARKP YLHESRHQHA MRRARGSGGR FAKKSDADTS KGTGSGSDVS SQSINSTGSE  300
PLLSKSSGAK APEPQNLYDS AASNFRKQTN LQEPVYQSHS GEMGEGPASS QQWGNIPSNH  360
ALAMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-20215289276NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090023.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
TrEMBLA5PGU31e-154A5PGU3_ANTMA; YA4
STRINGPGSC0003DMT4000277851e-116(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31112248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.34e-54nuclear factor Y, subunit A1