PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011089822.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 238aa    MW: 27243.7 Da    PI: 8.3198
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011089822.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.8e-184287148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T+ E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
   XP_011089822.1 42 RGKMTPHEERLVLELHSKYGNR-WSRIARKLP-GRTDNEIKNYWRTHM 87
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.482136IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.8E-92248IPR009057Homeodomain-like
SuperFamilySSF466891.38E-222292IPR009057Homeodomain-like
PROSITE profilePS5129425.7133791IPR017930Myb domain
SMARTSM007171.3E-174189IPR001005SANT/Myb domain
PfamPF002491.6E-154286IPR001005SANT/Myb domain
CDDcd001671.10E-124487No hitNo description
Gene3DG3DSA:1.10.10.604.7E-214988IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGFHSKSFRF AGWRETEYIG LKRTGKSCRL RWVNYLHPGL KRGKMTPHEE RLVLELHSKY  60
GNRWSRIARK LPGRTDNEIK NYWRTHMRKM AQERKKGAAS PSVSASSLSS NSSSSSISNS  120
PTAELISTPA LQAKEHSFYD TGGMELMAAA PGEKKITSSK AEESPKVYSM EDIWEDFEFS  180
QENCNQLMTC QAVASPIWDY CPTDHSLQLW SMDEEESRLP MQPIGDDHFH SFPYYMTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-18238937103MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-17238991157MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-17238991157MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-17238960126MYB TRANSFORMING PROTEIN
1mse_C7e-18238937103C-Myb DNA-Binding Domain
1msf_C7e-18238937103C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011089822.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR7800911e-78KR780091.1 Rehmannia glutinosa R2R3-MYB protein (MYB15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089822.11e-180transcription factor MYB48 isoform X2
SwissprotQ9LX821e-52MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0K1SBK08e-80A0A0K1SBK0_REHGL; R2R3-MYB protein
STRINGMigut.N02661.1.p5e-83(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.44e-59myb domain protein 48
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nishida S,Kakei Y,Shimada Y,Fujiwara T
    Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana.
    Plant J., 2017. 91(4): p. 741-753
    [PMID:28586097]
  4. Imran QM, et al.
    Transcriptome profile of NO-induced Arabidopsis transcription factor genes suggests their putative regulatory role in multiple biological processes.
    Sci Rep, 2018. 8(1): p. 771
    [PMID:29335449]