PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011088547.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family BBR-BPC
Protein Properties Length: 308aa    MW: 34798.3 Da    PI: 10.2673
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011088547.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind327.44.1e-10013081301
       GAGA_bind   1 mdddgsre..rnkg.yye...........paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkl 81 
                     md++g+re  r++  yy+            +++ + +++ ++  +  erda+i+er+ al+ekk a++erd+a +qrd+a+a+r++al erdn++
  XP_011088547.1   1 MDENGQREsrRHRVdYYKvppwnmisqyqTKEQNAYHVNAKISMLCDERDAAIQERDRALAEKKVALNERDVAIQQRDAAIADRDNALRERDNAI 95 
                     9999999998888899*9******99885225666789999988888************************************************ PP

       GAGA_bind  82 lalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskk 176
                     +al+++e +++ +l+++ + l+ t++  + q     +  +sa +l e+ +++alpi+  +++a++++++k +++ +++k+k  +k+k+k+e+ ++
  XP_011088547.1  96 AALQFHESTMNAVLGNNARGLKRTNHPRNQQA----NNVKSARNLGERCITNALPISAIPSDAEKEERTKVNKNITSKKTKSPRKVKRKGEDLNR 186
                     *********99999888888888877775554....445566778899999***************************************99999 PP

       GAGA_bind 177 kvkkesaderskaekksidl.vlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLe 270
                     + ++e+    skae++ +++ ++  +s++est+PvP+CsCtGa+rqCYkWGnGGWqS+CCtt+iSvyPLP+ +++r+aR++grKmS+++f++lL 
  XP_011088547.1 187 NITTEG----SKAEWEAQEFgSISPISFNESTMPVPICSCTGAPRQCYKWGNGGWQSSCCTTSISVYPLPQIPNKRHARMGGRKMSGSVFSRLLT 277
                     999988....89********88************************************************************************* PP

       GAGA_bind 271 kLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     ++a+ G+dls p+DLk++WAkHGtn+++ti+
  XP_011088547.1 278 RMASAGHDLSIPIDLKNYWAKHGTNRYITIK 308
                     ******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012266.0E-1151308IPR010409GAGA-binding transcriptional activator
PfamPF062173.3E-901308IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MDENGQRESR RHRVDYYKVP PWNMISQYQT KEQNAYHVNA KISMLCDERD AAIQERDRAL  60
AEKKVALNER DVAIQQRDAA IADRDNALRE RDNAIAALQF HESTMNAVLG NNARGLKRTN  120
HPRNQQANNV KSARNLGERC ITNALPISAI PSDAEKEERT KVNKNITSKK TKSPRKVKRK  180
GEDLNRNITT EGSKAEWEAQ EFGSISPISF NESTMPVPIC SCTGAPRQCY KWGNGGWQSS  240
CCTTSISVYP LPQIPNKRHA RMGGRKMSGS VFSRLLTRMA SAGHDLSIPI DLKNYWAKHG  300
TNRYITIK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088547.10.0PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_011088549.10.0PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_011088550.10.0PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_011088551.10.0PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
SwissprotQ8S8C61e-106BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A068TKY01e-150A0A068TKY0_COFCA; Uncharacterized protein
STRINGSolyc01g110470.2.11e-141(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA92872128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-104basic pentacysteine 4