PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087615.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ZF-HD
Protein Properties Length: 291aa    MW: 32559.6 Da    PI: 7.5349
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087615.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.28.1e-3376132259
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     + vrY+eClkNhAas+Gg+a+DGCgEfmps geegt +al+C+AC+CHRnFHR+eve 
  XP_011087615.1  76 KMVRYRECLKNHAASMGGNATDGCGEFMPS-GEEGTLEALTCSACNCHRNFHRKEVEG 132
                     679**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-2578133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.0E-3078130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.9E-3179130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.52480129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.65E-19214279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-31215280IPR009057Homeodomain-like
TIGRFAMsTIGR015652.8E-27218274IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MELPSHQEGD EMPIPLNSMI HHHGHGHMIH HHDPASHIIP SSGGGPPHQI PSNGPPISHD  60
HEHDHDHDHE HLPFKKMVRY RECLKNHAAS MGGNATDGCG EFMPSGEEGT LEALTCSACN  120
CHRNFHRKEV EGEPSSCDGC YPNPRMGRKL FMGGHHNALA YHHHHHHGAP LISSRPVPPH  180
QMIMSYNMAG SLPSESDEHE DGGGGGGGVV VRPTPVVKKR FRTKFTQEQK EKMLSFAEKV  240
GWKIQKQEES VVQQFCQEVG VKRRVLKVWM HNNKHNLAKK NLNHSNPQNQ V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-242192761875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00258DAPTransfer from AT2G02540Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011087615.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0428533e-58KJ042853.1 Sesamum indicum clone TilSSR_14054 microsatellite Sesame_14054 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087615.10.0zinc-finger homeodomain protein 4
SwissprotO647221e-75ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLF6HJZ61e-119F6HJZ6_VITVI; Uncharacterized protein
STRINGVIT_12s0035g01880.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-66homeobox protein 31
Publications ? help Back to Top
  1. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]
  2. Li B, et al.
    Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis.
    Plant Cell, 2018. 30(1): p. 178-195
    [PMID:29317470]