PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 293aa    MW: 33418 Da    PI: 4.8052
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087214.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-2089142356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++++q++ Le+ Fe ++++  e++ +LAk+lgL+ rq+ +WFqNrRa++k
  XP_011087214.1  89 KKRRLSADQIQFLEKSFEAENKLEPERKIQLAKELGLPPRQIAIWFQNRRARWK 142
                     56689************************************************9 PP

2HD-ZIP_I/II125.13.1e-4089178291
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     kkrrls++q+++LE+sFe+e+kLeperK +la+eLgl prq+a+WFqnrRAR+kt+qlE+dy++L+++y +lk++ ++L ke+e+L++e+
  XP_011087214.1  89 KKRRLSADQIQFLEKSFEAENKLEPERKIQLAKELGLPPRQIAIWFQNRRARWKTRQLETDYDTLHASYMSLKTNYDNLLKENEKLKAEV 178
                     9**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.3E-2067146IPR009057Homeodomain-like
PROSITE profilePS5007117.29784144IPR001356Homeobox domain
SMARTSM003894.7E-2086148IPR001356Homeobox domain
CDDcd000868.05E-1987145No hitNo description
PfamPF000461.0E-1789142IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-2191151IPR009057Homeodomain-like
PRINTSPR000319.2E-6115124IPR000047Helix-turn-helix motif
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PRINTSPR000319.2E-6124140IPR000047Helix-turn-helix motif
PfamPF021832.7E-14145183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MAVRRVVYGG GDSLDPTQKL KISSHDQQPL DSVFASAPSK PFLVSGSRAM LSFGSVGGAN  60
RSGNLFFSSS DQEESGDEYL EEYFSQPGKK RRLSADQIQF LEKSFEAENK LEPERKIQLA  120
KELGLPPRQI AIWFQNRRAR WKTRQLETDY DTLHASYMSL KTNYDNLLKE NEKLKAEVLR  180
LKDNGLARDT DKALFQEMLK ETIADMISQD EESKVSAVAF KNEDQSLESG DSSHVVEPDR  240
SDLSQNGEDD LNEELLQPDY MFHKIEDAHR HHPASSFYCG FPAEDHIFSF WSY
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011087214.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087214.10.0homeobox-leucine zipper protein HAT5
TrEMBLA0A2G9G9Z31e-122A0A2G9G9Z3_9LAMI; Transcription factor HEX
STRINGMigut.D01856.1.p1e-108(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-42homeobox 1