PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087184.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 312aa    MW: 33451.7 Da    PI: 9.4177
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087184.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.8e-14103147347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r   k+Rt+ q+ s+ qky
   XP_011087184.1 103 PWTEEEHKLFLLGLQKVGKGDWRGISRNYVKTRTPTQVASHAQKY 147
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.01196152IPR017930Myb domain
SuperFamilySSF466896.36E-1798153IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-1799150IPR006447Myb domain, plants
SMARTSM007173.8E-10100150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-11102147IPR009057Homeodomain-like
CDDcd001671.21E-9103148No hitNo description
PfamPF002492.3E-11103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSASGESPSA AVSSGGSCGG GGGVGEFMLF GVRVKVDPMR KCVSMNNLSE YEPVSNTSNP  60
SDNSGTELPK AAAEGGVAAG YASADDAVPQ PSNGSRERKR GVPWTEEEHK LFLLGLQKVG  120
KGDWRGISRN YVKTRTPTQV ASHAQKYFLR RSNLNRRRRR SSLFDITTDS VTALPMEEGK  180
YQKDSSTPPA LQPTTMPLPV NSNINGFSVM PFPATGGPVL LPMQGVNPME NLIQNDRVNN  240
PSALLVHPVP ILPMPTSSTM VDLNLNHQVP LDPSPLSLRL SLSSGHDQSS RRDLSFQVFS  300
SFKNGDSIIS VA
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011087184.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087184.10.0transcription factor MYB1R1-like
SwissprotQ2V9B04e-86MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A2G9GK841e-120A0A2G9GK84_9LAMI; Uncharacterized protein
STRINGMigut.D01891.1.p1e-107(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.22e-51MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]