PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087055.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 363aa    MW: 40021.3 Da    PI: 4.7365
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087055.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.9e-18206260256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_011087055.1 206 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 260
                     778899***********************************************98 PP

2HD-ZIP_I/II1278.2e-41206296192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  XP_011087055.1 206 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLSEENRRLHKELQELR-ALK 296
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-17191260IPR009057Homeodomain-like
SuperFamilySSF466892.31E-18196263IPR009057Homeodomain-like
PROSITE profilePS5007117.119202262IPR001356Homeobox domain
SMARTSM003891.3E-15204266IPR001356Homeobox domain
PfamPF000463.2E-15206260IPR001356Homeobox domain
CDDcd000863.82E-16206263No hitNo description
PROSITE patternPS000270237260IPR017970Homeobox, conserved site
SMARTSM003405.8E-25262305IPR003106Leucine zipper, homeobox-associated
PfamPF021839.9E-11262296IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MELGLSLGDG VGFLREDNNT EKSTKQKIKS TGLDFCMGLG LNSSAAAGGD DQEREKPQKI  60
TNEDDDDDDD DDDDDQMSEG DNQGSDDDNT PVQLNLLPLA PVPRRALPNW STSDNGSPEN  120
GSSGNMGLPV AARGLDVNRF PPAEEVSSAN SVGTTSPFHM EFGLLRRGTG YLQLGGQKRA  180
FEAATGNDVV ESERGSDDDE NGLQTRKKLR LSKEQSAFLE ESFKEHSTLN PKQKLALAKQ  240
LNLRPRQVEV WFQNRRARTK LKQTEVDCEY LKRCCETLSE ENRRLHKELQ ELRALKTSNP  300
FYMQLPATTL TMCPSCERVA TAPPPTAAAE SIPKPIPAFP LTRPRFYPFS QTPTGHPNQP  360
APS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204210TRKKLRL
2254262RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087055.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like isoform X2
TrEMBLA0A0V0I3B81e-118A0A0V0I3B8_SOLCH; Putative homeobox-leucine zipper protein HOX27-like
STRINGPGSC0003DMT4000161461e-117(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-65homeobox from Arabidopsis thaliana