PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011086971.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 474aa    MW: 52780.4 Da    PI: 5.8487
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011086971.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.5e-165599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE++++++a k++G   W+ I +++g ++t+ q++s+ qk+
   XP_011086971.1 55 RERWTEEEHQKFLEALKLYGRA-WRHIEEYVG-TKTAIQIRSHAQKF 99
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.11E-1649104IPR009057Homeodomain-like
PROSITE profilePS5129420.750104IPR017930Myb domain
TIGRFAMsTIGR015579.4E-1753102IPR006447Myb domain, plants
SMARTSM007171.1E-1254102IPR001005SANT/Myb domain
PfamPF002495.1E-135598IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-85595IPR009057Homeodomain-like
CDDcd001679.92E-1057100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MVAEAKEQVV ATSEDASFMV NSQLESVAGQ SKSLRSNGSS YTLKVRKPYT ITKQRERWTE  60
EEHQKFLEAL KLYGRAWRHI EEYVGTKTAI QIRSHAQKFF AKVTRDSSMD AEGSLDPIQI  120
PPPRPKKKPL HPYPRKFVDP VNREITVPNR LEISHSPDAS VPEKDNLSPT SVLSVVGSDT  180
LESTVAEMHE SCLSPASCSI DAPSTCSLLP ERDDEYITSE ISANEENGFR LSMKTSSNLV  240
PDKNSPMKLK LFPQEAECAI DSPQAEEPYT RIKLFGKTVM VRDASKQSLE VVENSQSLPP  300
DIIDKKLDNN ADELVKDRAL ISTSQYLEDT VECDSKSVIP SSLPQHPLNN IHCHMMNVFG  360
LPWWMWHQGV VYPSASSCQE VASQNAECSL IGKGLESEQL QLNGSLNGPK APISEANTEN  420
RNNEASEGKH LFDTGKKEPA KGFVAYKRCL AERDGRSSMS LLQEREGQRA RVCS
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011086971.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086968.10.0protein REVEILLE 2 isoform X1
TrEMBLA0A2G9I4Z51e-114A0A2G9I4Z5_9LAMI; Transcription factor, Myb superfamily
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-42MYB_related family protein