PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011086401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 318aa    MW: 36189.9 Da    PI: 4.6077
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011086401.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-1986139356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t++q++ Le+ F +++++  e++ +LAk+lgL+ rqV +WFqNrRa++k
  XP_011086401.1  86 KKRRLTPNQVQFLEKSFDEENKLEPERKLQLAKELGLQPRQVAIWFQNRRARYK 139
                     56789************************************************9 PP

2HD-ZIP_I/II1261.7e-4085177193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl+ +qv++LE+sF+ee+kLeperK +la+eLglqprqva+WFqnrRAR+ktk lEk++++Lk++yd+lk++ ++L ke+e+L++e+++
  XP_011086401.1  85 EKKRRLTPNQVQFLEKSFDEENKLEPERKLQLAKELGLQPRQVAIWFQNRRARYKTKLLEKEFDSLKSSYDRLKADYDTLYKENEKLKTEVNS 177
                     69**************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-1979141IPR009057Homeodomain-like
PROSITE profilePS5007117.65381141IPR001356Homeobox domain
SMARTSM003891.5E-1884145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.7E-1986139IPR009057Homeodomain-like
PfamPF000465.6E-1786139IPR001356Homeobox domain
CDDcd000863.81E-1786141No hitNo description
PRINTSPR000316.8E-6112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000316.8E-6121137IPR000047Helix-turn-helix motif
PfamPF021833.0E-13142181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEVYDDSRIS NALLKNERLP CTSEVLDSLW VQNSSPSFHA SASMVNFANV QGETKTERPF  60
LPQIDTKAEN CNEGALDGCS FHHPEKKRRL TPNQVQFLEK SFDEENKLEP ERKLQLAKEL  120
GLQPRQVAIW FQNRRARYKT KLLEKEFDSL KSSYDRLKAD YDTLYKENEK LKTEVNSLAE  180
KSRLRDNGKP KTEQCDDPIS PLDLQPNKPI CSQNAAQTVA SKQEDAASSA KSDVFDSDSP  240
HYTDGNHSAA LEPADSSHVF EPDASDFSQD EDDSFNRSCL MPSLSFPKLE VECFDDLQPN  300
SCNLGFPVQD QGTWFWQY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086401.10.0PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022832e-43HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A068TVH71e-127A0A068TVH7_COFCA; Uncharacterized protein
STRINGSolyc05g006980.2.11e-107(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-44homeobox 1