Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085929.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 699aa    MW: 78887.8 Da    PI: 7.0979
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085929.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ ++++++q+++Le++++++++p++++r++L+++lgL+++q+k+WFqN+R++ k
                    688899**********************************************9877 PP

           START   4 eeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                      +a++elv +  ++ep+Wvk +                 + + +k             + e +++sg v m++  l e lld++ +W+ ++    
                     5799******************65543333.........4444333444445677999**************************.********** PP

           START  78 .kaetlevissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                      ka t+ev+++g   g l+lm+ +l  lsplv+ R+f f+Ry+rql+  +wv vdvS d  ++ + +++  R+ +lpSg++ie++sng+s+vtw+
                     ********************************99***************************9999.999************************** PP

           START 168 ehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     ehv +++++  h l+r lv  ++a gak+w  tlqr ce+
                     ******99988***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.7951979IPR001356Homeobox domain
SMARTSM003893.1E-172183IPR001356Homeobox domain
CDDcd000869.62E-172280No hitNo description
PfamPF000461.1E-162277IPR001356Homeobox domain
PROSITE patternPS0002705477IPR017970Homeobox, conserved site
PROSITE profilePS5084842.858206439IPR002913START domain
SuperFamilySSF559613.3E-29208437No hitNo description
CDDcd088752.39E-97210435No hitNo description
SMARTSM002344.9E-31215436IPR002913START domain
PfamPF018521.1E-37218436IPR002913START domain
Gene3DG3DSA:3.30.530.204.6E-8274402IPR023393START-like domain
SuperFamilySSF559614.12E-14459686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085928.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like isoform X1
RefseqXP_011085929.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like isoform X1
TrEMBLA0A022QU910.0A0A022QU91_ERYGU; Uncharacterized protein
STRINGVIT_04s0079g00480.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11