PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 699aa    MW: 78887.8 Da    PI: 7.0979
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085928.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.7e-192277156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ ++++++q+++Le++++++++p++++r++L+++lgL+++q+k+WFqN+R++ k
  XP_011085928.1 22 KKQYHRHSTQQIQQLEAFYKECPHPDKNQRQQLSRELGLDQKQIKFWFQNKRTQIK 77
                    688899**********************************************9877 PP

2START141.58.6e-452184364206
                     HHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
           START   4 eeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                      +a++elv +  ++ep+Wvk +                 + + +k             + e +++sg v m++  l e lld++ +W+ ++    
  XP_011085928.1 218 ISAMDELVELLRVNEPVWVKAPsdgryllH---------RDSYDKLfpkpnhfktasARFESSKDSGEVSMAAIHLIEMLLDVN-KWKDMFStiv 302
                     5799******************65543333.........4444333444445677999**************************.********** PP

                     .EEEEEEEECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
           START  78 .kaetlevissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                      ka t+ev+++g   g l+lm+ +l  lsplv+ R+f f+Ry+rql+  +wv vdvS d  ++ + +++  R+ +lpSg++ie++sng+s+vtw+
  XP_011085928.1 303 tKARTIEVLDTGslgGLLHLMYEKLHILSPLVApREFFFIRYCRQLNLNTWVMVDVSYDFIKELQ-DAPPTRSWKLPSGCMIEDMSNGKSTVTWI 396
                     ********************************99***************************9999.999************************** PP

                     E-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 168 ehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     ehv +++++  h l+r lv  ++a gak+w  tlqr ce+
  XP_011085928.1 397 EHVQVDDKSLtHRLYRDLVCGCQAYGAKRWITTLQRMCER 436
                     ******99988***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-18980IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-20981IPR009057Homeodomain-like
PROSITE profilePS5007116.7951979IPR001356Homeobox domain
SMARTSM003893.1E-172183IPR001356Homeobox domain
CDDcd000869.62E-172280No hitNo description
PfamPF000461.1E-162277IPR001356Homeobox domain
PROSITE patternPS0002705477IPR017970Homeobox, conserved site
PROSITE profilePS5084842.858206439IPR002913START domain
SuperFamilySSF559613.3E-29208437No hitNo description
CDDcd088752.39E-97210435No hitNo description
SMARTSM002344.9E-31215436IPR002913START domain
PfamPF018521.1E-37218436IPR002913START domain
Gene3DG3DSA:3.30.530.204.6E-8274402IPR023393START-like domain
SuperFamilySSF559614.12E-14459686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MDSSYGGNGS GEEETSNSQK GKKQYHRHST QQIQQLEAFY KECPHPDKNQ RQQLSRELGL  60
DQKQIKFWFQ NKRTQIKAQN ERADNNALRA ENERIHCENL AMQEALKNII CPACNGSGLG  120
EEEKHHNLQR LRMENARLKE EHERTINFFS NYMGNSTTPL PGVDSHMNIH GKHFLGERMG  180
ITPLDLEHMP RNSENTISPH WSSGIQEAEK SIIIETTISA MDELVELLRV NEPVWVKAPS  240
DGRYLLHRDS YDKLFPKPNH FKTASARFES SKDSGEVSMA AIHLIEMLLD VNKWKDMFST  300
IVTKARTIEV LDTGSLGGLL HLMYEKLHIL SPLVAPREFF FIRYCRQLNL NTWVMVDVSY  360
DFIKELQDAP PTRSWKLPSG CMIEDMSNGK STVTWIEHVQ VDDKSLTHRL YRDLVCGCQA  420
YGAKRWITTL QRMCERFAFS MGLTTTHKHE LEGVIDSLEG RRNLMKLSHR MMNNFCEALS  480
MSDKLDFPHL SEFKNSGVRV SLRKSNGLGQ PDGFIVSAAT SLWLPVSNEN LFNFFKDEKK  540
RVQWDVLSSG NPVNAVAHIS TGTHPGNCIS IIQQPFVPKE NNMLMLQESS IDPLGAIMIY  600
APIDLQAIIS VVNGEDTMRI PILPSGYVIS SDGRANKGMG ASSSSSSNSS SGSLLTVAFQ  660
ILVCHSTLTK QLNMESVATV HTLISSTIQK IKAALDYPD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085928.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like isoform X1
RefseqXP_011085929.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like isoform X1
TrEMBLA0A022QU910.0A0A022QU91_ERYGU; Uncharacterized protein
STRINGVIT_04s0079g00480.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24902351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11